DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mcm7 and Mcm9

Sequence 1:NP_523984.1 Gene:Mcm7 FlyBaseID:FBgn0020633 Length:720 Species:Drosophila melanogaster
Sequence 2:XP_008771230.1 Gene:Mcm9 RGDID:1560557 Length:1128 Species:Rattus norvegicus

Alignment Length:632 Identity:195/633 (31%)
Similarity:317/633 (50%) Gaps:85/633 (13%)


  Fly    80 VIAELLPSYKQQEVHAKDAL------DVYIEHRLMMESRT--RNPMEQRDERNSFPSELMKRFEV 136
            ::.::..|| ..|.|..|.|      |....:.|::.:.|  ...||..|....||:|::..|:.
  Rat     8 LVGQVFESY-VSEYHKNDILLILKERDEDAHYPLVVNAMTLFETNMEIGDYFTVFPNEVLTVFDS 71

  Fly   137 GFKPLSTEKAHSIRE----------------------------VKAQHIGKLVTVRGIVTRCTEV 173
            ..:..:.....|:.|                            .|.:.:|..::|.|.|.|.:.|
  Rat    72 ALRRSALAVLQSLPEPEGLSMKQNLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLV 136

  Fly   174 KPMMVVATYTCDRC--------GSETYQPVNSLSFTPVHDCPSDD-CRVNKAGGRLYLQTRGSKF 229
            |.:.....|.|::|        ..|.|     .:|:....|||.| |..:|......|....::.
  Rat   137 KVLEFERDYMCNKCKYVFTVKADFEQY-----YTFSRPSSCPSSDTCDSSKFTCLSDLSASPARC 196

  Fly   230 VKFQEVKMQEHSDQVPVGHIPRSMTIMCRGEVTRMAQPGDHIVVSGVFL----PLMRTGFAQMIQ 290
            ..:||:|:||...::.||.|||||.::...::....:.||.:.:.||.:    |..|....::  
  Rat   197 RDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGVVMQRWKPFQRDMRCEV-- 259

  Fly   291 GLLSETFLQAHRIICINKNDE--ISDKDAELTPEEL-EELAQDDFYER--LATSLAPEIYGHLDV 350
                |..|:|:.:...|:...  :.|:||....|:. |....|.|..|  :..||.|:::|...|
  Rat   260 ----EIVLKANYVQVNNEQSSGMVMDEDARKEFEDFWEHYKSDPFAGRNEILASLCPQVFGMYLV 320

  Fly   351 KKALLLLLVGGVDKRPD--GMKIRGNINICLMGDPGVAKSQLLGYISRLAVRSQYTTGRGSSGVG 413
            |.|:.::|.||: :|.|  |.::||..::.|:||||..|||.|.|.:::..||..|||.||:..|
  Rat   321 KLAVAMVLAGGI-QRTDAAGTRVRGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAG 384

  Fly   414 LTAAVMKDPLTGEMTLEGGALVLADQGVCCIDEFDKMADQDRTAIHEVMEQQTISIAKAGIMTTL 478
            ||...:||  :||..||.|||||||.|:||||||:.:.:.|||:|||.|||||||:||||::..|
  Rat   385 LTVTAVKD--SGEWNLEAGALVLADAGLCCIDEFNSLKEHDRTSIHEAMEQQTISVAKAGLVCKL 447

  Fly   479 NARVSILAAANPAFGRYNPRRTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAKHITYVHSH 543
            |.|.:||||.||. |:|:|:.:|..||.|.:.|||||||:.::.|..:.|.|..::..|.    .
  Rat   448 NTRTTILAATNPK-GQYDPQESVSVNIALGSPLLSRFDLILVLLDTRNEDWDRIISSFIL----E 507

  Fly   544 SKQPPTRVKAL-DMNLMRRYINLCKRKNPTIPDELTDYIVGAYVELRREARNQKDMTFTSARNLL 607
            :|..|::.:.| .|..|:.|..|.:..:||:.| :::.::..|.:::|:: :.::...|:.|.|.
  Rat   508 NKGYPSKSENLWSMEKMKTYFCLIRNLHPTLSD-VSNQVLLRYYQMQRQS-DSRNAARTTIRLLE 570

  Fly   608 GILRLSTALARLRLSDSVEKDDVAEALRLLEMSKD------SLNQIH 648
            .::||:.|.|||....:|..:|....:.::|.|..      .:|.:|
  Rat   571 SLIRLAEAHARLMFRSTVTLEDAITVVSVMESSMQGGALLGGVNALH 617

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mcm7NP_523984.1 MCM_N 13..165 CDD:291233 21/121 (17%)
MCM 145..641 CDD:214631 177/545 (32%)
P-loop_NTPase 376..515 CDD:304359 77/139 (55%)
MCM_bind <556..619 CDD:286782 17/63 (27%)
Mcm9XP_008771230.1 MCM_N 13..128 CDD:291233 21/116 (18%)
MCM 116..603 CDD:214631 174/508 (34%)
P-loop_NTPase 347..483 CDD:304359 77/139 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D232729at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.