DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mcm7 and mcm-2

Sequence 1:NP_523984.1 Gene:Mcm7 FlyBaseID:FBgn0020633 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_001022416.1 Gene:mcm-2 WormBaseID:WBGene00003154 Length:881 Species:Caenorhabditis elegans

Alignment Length:709 Identity:234/710 (33%)
Similarity:354/710 (50%) Gaps:119/710 (17%)


  Fly     4 RDYAQD-------RESIKTFLSEFCKCDDDGKKEFVYGSQLVKLAHREQVLITIDLDDLAEFNES 61
            ||:..|       ....|.||..|   .:.|.|:..|...:..:|...:..:.:...||::    
 Worm   156 RDHVSDEAVAKEIERRFKNFLRSF---HEPGNKQTKYIQMIKSMAADNRESLEVSFTDLSD---- 213

  Fly    62 LAEAVVDNCRRYTSIFSDVIAELLPSYKQQEVHAKD--ALDVYIEHRLMMESRTRNPMEQRDERN 124
                  ||..:..|.|       ||....:.:...|  |.:|.:                    |
 Worm   214 ------DNGEQNISYF-------LPEAPNEMLAIMDRAATEVVM--------------------N 245

  Fly   125 SFP--SELMKRFEVGFKPLSTEKAHSIREVKAQHIGKLVTVRGIVTRCTEVKPMMVVATYTCDRC 187
            .:|  |.:....:|....|..|:  .||.::..|:..|:...|:||..:.:.|.:.|..|.|..|
 Worm   246 MYPFYSRVCNEIKVRISQLPVEE--DIRMLRQVHLNMLIRTAGVVTIASGILPQLAVVKYDCVAC 308

  Fly   188 G----------SETYQPVNSLSFTPVHDCPSDDCRVNKAGGRLYLQTRGSKFVKFQEVKMQEHSD 242
            |          .|..:|.         .|||  |   :..|...|....:.:..:|.:.|||..:
 Worm   309 GYLLGPFVQQNDEEVRPT---------ICPS--C---QGKGPFELNVENTVYHNYQRITMQESPN 359

  Fly   243 QVPVGHIPRSMTIMCRGEVTRMAQPGDHIVVSGVFLPLMRTGFAQMIQGL-LSETFLQAHRIICI 306
            :|..|.:|||..::..|::....:|||.|.|:||:.... .|.....||. :..|.:.|:.|  .
 Worm   360 KVAAGRLPRSKDVILLGDLCDSCKPGDEIEVTGVYTNNF-DGSLNYKQGFPVFNTLIHANHI--T 421

  Fly   307 NKNDEISDKDAELTPEELE---ELAQD-DFYERLATSLAPEIYGHLDVKKALLLLLVGGVDKRPD 367
            ||:...||   :||.|:::   ||:|| :..:|:.:|:||.||||.|||:|:.|.|..|..|.|.
 Worm   422 NKDKMASD---QLTDEDIKAIRELSQDPNISQRVFSSIAPSIYGHDDVKRAIALALFRGEAKNPG 483

  Fly   368 GM-KIRGNINICLMGDPGVAKSQLLGYISRLAVRSQYTTGRGSSGVGLTAAVMKDPLTGEMTLEG 431
            .. ::||:||:.|.||||.||||.|.|.:.:|.||..|||:|:|.|||||.|.:.|:|.|.|||.
 Worm   484 AKHRLRGDINVLLCGDPGTAKSQFLRYAAHIAPRSVLTTGQGASAVGLTAYVQRHPVTREWTLEA 548

  Fly   432 GALVLADQGVCCIDEFDKMADQDRTAIHEVMEQQTISIAKAGIMTTLNARVSILAAANPAFGRYN 496
            ||:||||:|||.|||||||:|||||:|||.||||:|||:||||:|:|:||.:::||:||..||||
 Worm   549 GAMVLADKGVCLIDEFDKMSDQDRTSIHEAMEQQSISISKAGIVTSLHARCTVIAASNPIGGRYN 613

  Fly   497 PRRTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAKHITYVHSHSKQPP------------- 548
            |.||..:|:.|...:|||||:|.:|:|..|...|.||||.:  |.:|....|             
 Worm   614 PTRTFAENVDLTEPILSRFDVLCVIRDSVDSVEDERLAKFV--VGNHRTHHPDAKKIVKEGDELE 676

  Fly   549 -------TRVKALDMNLMRRYINLCKRK-NPTIPDELTDYIVGAYVELRREARNQKDMTFTSARN 605
                   |.|:.:..:|:|:||...:.| :||:|::.::.....:.::|:|:.....:..| .|:
 Worm   677 EDQMDERTGVRLIPQDLLRKYIIYAREKCHPTLPEQHSEKFSNIFAQMRKESMATGSVAIT-VRH 740

  Fly   606 LLGILRLSTALARLRLSDSVEKDDVAEALRLLEMSKDSLNQIHEHQKGHVPNTSDRIFA 664
            :..::|||.|.|:|.|...|..:|.|.|:|::      |......||..:.....:.|:
 Worm   741 VESMIRLSEAHAKLHLRSYVNDEDCAAAIRVM------LESFVNTQKASIMRMMKKTFS 793

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mcm7NP_523984.1 MCM_N 13..165 CDD:291233 29/156 (19%)
MCM 145..641 CDD:214631 202/533 (38%)
P-loop_NTPase 376..515 CDD:304359 87/139 (63%)
MCM_bind <556..619 CDD:286782 17/64 (27%)
mcm-2NP_001022416.1 MCM2_N 48..>103 CDD:289392
MCM_N 171..286 CDD:291233 29/157 (18%)
MCM 270..777 CDD:214631 203/536 (38%)
AAA 461..639 CDD:99707 106/178 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D232729at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.