DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mcm7 and mcm8

Sequence 1:NP_523984.1 Gene:Mcm7 FlyBaseID:FBgn0020633 Length:720 Species:Drosophila melanogaster
Sequence 2:XP_002665161.2 Gene:mcm8 ZFINID:ZDB-GENE-120927-1 Length:852 Species:Danio rerio

Alignment Length:725 Identity:221/726 (30%)
Similarity:343/726 (47%) Gaps:123/726 (17%)


  Fly    31 FVYGSQLV-KLAHREQVLIT-IDLDDLAEFNESLAEAVVDNCRRYTSIFSD-----VIAELLPSY 88
            ||..|..| |:...||...: |||.|..|. |.....:||    |..:.|:     .:.:|....
Zfish    98 FVESSPYVEKIKVFEQYFTSQIDLYDKDEI-ERKGSILVD----YKDLLSNKQVSHSLPDLARDL 157

  Fly    89 KQQEVHAKDALDVYIEHRLMMESRTRNPMEQRDERNSFPSELMKRFEVGFKPL-----------S 142
            |:......|.|.|.|...|.::.          ||::...:..:....|.:|:           :
Zfish   158 KEMPEKILDCLGVAIHQVLTLDL----------ERHAAELQGQEELPAGIRPIINIPHISARLYN 212

  Fly   143 TEKAHSIREVKAQHIGKLVTVRGIVTRCTEVKPMMVVATYTCDRCGSETYQPVNSLSFTPVHDCP 207
            .|....::.::|...||.|.:||.|.|.:.:||:.:...:.|:.||......:....:|....|.
Zfish   213 YEPLTPLKSLRANLYGKFVVIRGTVVRVSNIKPLCMKLAFVCNSCGDTQSVTLPDGKYTMPTKCL 277

  Fly   208 SDDCRVNKAGGRLYLQTRGSKF---VKFQEVKMQE--HSDQVPVGHIPRSMTIMCRGEVTR---- 263
            ..:||     ||.:...|.|.|   |.:|.:|:||  ..||...|.|||  ||.|  |:|:    
Zfish   278 QSECR-----GRSFTPNRSSPFTLTVDWQTIKVQELMSGDQRESGRIPR--TIEC--ELTQDLVD 333

  Fly   264 MAQPGDHIVVSGVFLPLMRTGFAQ----MIQGLLSETFLQAHRIICI--NKNDEISDKD-----A 317
            ...|||.:.::||.......|..:    ....||   ::||:.:...  .|:..:|:.:     .
Zfish   334 SCVPGDMVTITGVIKVSNEEGSTRNKKDKCMFLL---YIQANSVSNSKGQKSKAVSESEGQGPSV 395

  Fly   318 ELTPEEL----EELAQDDFYERLATSLAPEIYGHLDVKKALLLLLVGGVDKRPDG---MKIRGNI 375
            |.:.::|    |..||:|.::.:..||.|.|||||.||..|.|.|.||..|..|.   :.|||:.
Zfish   396 EFSIKDLYAIQEIQAQEDLFKLIVNSLCPVIYGHLLVKAGLALALFGGCQKYVDDKNRIPIRGDP 460

  Fly   376 NICLMGDPGVAKSQLLGYISRLAVRSQYTTGRGSSGVGLTAAVMKDPLTGEMTLEGGALVLADQG 440
            ::.::||||:.|||:|..:..:|.|..|..|..::..|||.::.:|..:|:..||.|||||.|||
Zfish   461 HMLIVGDPGLGKSQMLQAVCNVAPRGVYVCGNTTTTSGLTVSLSRDSGSGDYALEAGALVLGDQG 525

  Fly   441 VCCIDEFDKMADQDRTAIHEVMEQQTISIAKAGIMTTLNARVSILAAANPAFGRYNPRRTVEQNI 505
            :|||||||||..|.: |:.|.||||:||:|||||:.||.||.||:|||||..|.||..:||.:|:
Zfish   526 ICCIDEFDKMGSQHQ-ALLEAMEQQSISLAKAGIVCTLPARTSIIAAANPVGGHYNKGKTVSENL 589

  Fly   506 QLPAALLSRFDLLWLIQDKPDRDNDLRLAKHI----------------TYVHSHSKQ-------- 546
            ::.:||||||||::::.|.|:.|:|..|::|:                |..::|...        
Zfish   590 KMGSALLSRFDLVFILLDTPNEDHDHLLSEHVMAMRAGKSGAVSGAAATRFNTHESSISILEVSS 654

  Fly   547 -----------PPTRVKALDMNLMRRYINLCKR-KNPTIPDELTDYIVGAYVELRREARNQ-KDM 598
                       |......:...|:|:|:...:. .:||:..|....:...|:|||::  || .|.
Zfish   655 EKPLADTLKLVPGEAFDPIPHQLLRKYVGYARHYVHPTLSAEAAQVLQDFYLELRKQ--NQTADS 717

  Fly   599 TFTSARNLLGILRLSTALARLRLSDSVEKDDVAEALRLLEMSKDSLNQIHEHQKGHVPNTSDRIF 663
            |..:.|.|..::||:.|.||:.|.:...:.|..:   ::|:.|.||...:..:.|.:.       
Zfish   718 TPITTRQLESLIRLTEARARVELREKATQSDAED---VVEIMKHSLTDTYSDEFGRLD------- 772

  Fly   664 AIVRELAGSG 673
             ..|...|||
Zfish   773 -FDRSQLGSG 781

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mcm7NP_523984.1 MCM_N 13..165 CDD:291233 34/152 (22%)
MCM 145..641 CDD:214631 184/560 (33%)
P-loop_NTPase 376..515 CDD:304359 72/139 (52%)
MCM_bind <556..619 CDD:286782 21/65 (32%)
mcm8XP_002665161.2 Mcm2 110..801 CDD:224162 216/714 (30%)
MCM_N 111..235 CDD:291233 29/139 (21%)
AAA 451..605 CDD:99707 78/155 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D232729at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.