DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dally and gpc1b

Sequence 1:NP_001246685.1 Gene:dally FlyBaseID:FBgn0263930 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_957314.1 Gene:gpc1b ZFINID:ZDB-GENE-040426-1306 Length:541 Species:Danio rerio

Alignment Length:571 Identity:129/572 (23%)
Similarity:231/572 (40%) Gaps:100/572 (17%)


  Fly    87 YSEKG----------------AIC--GGNCCNNATELELRDKAAGMFEQLLHHHTSSLRGVLETN 133
            ||.||                .:|  |..||.:..|..|.:.:...||..:.....||:..|...
Zfish    32 YSNKGFNLNGVPQTEISGEHLRVCAQGYTCCTSVMEENLLNLSRREFEMQVKESGRSLQAKLNGQ 96

  Fly   134 AKQFQSHVLELAQISENMTHSLFSKVYTRMVPSSRMMIHQLYTEIMNHLIYTSNYTNSNGQLGRR 198
            .|.|..:.|||...||....|.|...:..:......:...|::::..:      :..||      
Zfish    97 FKSFDEYFLELLNRSEASLQSSFQSGFGSLFSQMSKVFQDLFSDLRRY------FRGSN------ 149

  Fly   199 GIGSVQSNLEEAVRHFFVQLFPVAYHQMVHLSKNNLGDLHEDYVNCLQHNFDEMHPFGDIPQQVQ 263
                  .|||||:..|:.:|....:..:     |....:.|:|:.|:....:::.|||:.|::::
Zfish   150 ------VNLEEALNEFWARLLDRLFKAL-----NPQYSIGEEYLECVAKQSEKLKPFGETPRELK 203

  Fly   264 SNLGKSVHMSNVFMNALLQAAEVLSEADALYGEQLTDTCKLHLLKMHYCPNCNGHHSSSRSETKL 328
            :.:.::|..:..|:..|:.:.|.:.:...:   .|:..|...::|..|||:|:|     .:..|.
Zfish   204 TKITRTVIAARTFVQGLVISGEAVRKVSQV---SLSTECVRAVMKQTYCPHCSG-----VALAKP 260

  Fly   329 CYGYCKNVMRGCSAEYAGLLDSPWSGVVDSLNNLVTTHILSDTGIINVIKHLQTYFSEAIMAAMH 393
            |..||:||::||.|..|. ||:.|..:.|::..:| ..:.....:.:|:..|....:|||:....
Zfish   261 CSNYCRNVLKGCLANQAD-LDTEWRNLADAMLEVV-DKLSRPYSVDSVVLSLPKRIAEAILYMQD 323

  Fly   394 NGPELEKKVKKTCGTPSLTPYSSGEPDARPPPHKNNVKWATDPDPGMVL--FLSTIDK----SKE 452
            |......||...||||:  |.|:.:...:   ...|........||..|  .||.:.:    ..:
Zfish   324 NQDMFINKVFLECGTPA--PSSNIQEQIK---RGRNTAEEVSSTPGAQLERLLSDVSRMLRDMMQ 383

  Fly   453 FYTTIVDNFC-DEQQHSRDDHSCWSGDRFGDYTQLLINPGTDSQRYNPEVPFN-------AKAQT 509
            ::..:....| |.:....:...||:|...|.|...::..|..||..||||..:       .:.|.
Zfish   384 YWVHLPRKLCVDRESGPGESDRCWNGMSVGRYLPEVMGDGLASQINNPEVEIDITKPDMAVRKQI 448

  Fly   510 GKLNELVDKLFKIRKSIGAAAPSNSIQATHDIQNDMGEGSGGGEGQIGDDEEEYGGAHGSGDGSG 574
            .:|..::::|       ..|...|.:    |.|:...:.||.|.|...||:            ..
Zfish   449 MQLKIMINRL-------KYAVNGNDV----DFQDTSDDISGSGSGMCLDDQ------------CS 490

  Fly   575 DGPH--TPIEESEGTTTNEVESRD--SGKTSGSNPLEGTATWMLLTLVTML 621
            .||.  :|..:......:..|::.  :|::|.:.|   ..:..||:|||:|
Zfish   491 RGPRLMSPNTDKPKVYASPSENKKVVNGRSSQNLP---CISLYLLSLVTVL 538

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dallyNP_001246685.1 Glypican 51..622 CDD:279494 129/572 (23%)
gpc1bNP_957314.1 Glypican 6..538 CDD:279494 128/570 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3821
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.