DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13311 and CG34427

Sequence 1:NP_648258.1 Gene:CG13311 FlyBaseID:FBgn0035929 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001097553.2 Gene:CG34427 FlyBaseID:FBgn0085456 Length:269 Species:Drosophila melanogaster

Alignment Length:154 Identity:54/155 (35%)
Similarity:78/155 (50%) Gaps:10/155 (6%)


  Fly     6 ILRNLCLIVVVSSMAVLVQGVCNSCQANNVKCLNETHYSFCSDNVAP--NQVLQCPDNKVCTDLA 68
            :::.|.::|:...:|..|.. ||.||:|.|.|:|.|.:..|..:..|  :|:..|.:...||:|.
  Fly     8 VVKGLVMVVLAFMVAQTVSD-CNVCQSNQVACINSTSFYLCFGDGTPHRDQLYHCLEGFDCTNLT 71

  Fly    69 IICMD-SSVVDSSCSGTAD-GSCPTCDGNSMFVCTSRTTFQMCDG-TNLTGQVTKCKDNKICSIK 130
            .||:. ||....||..|:. |.| :.:.|.:|.|.||..||||.| |..|||...|....:|...
  Fly    72 AICVQKSSQRPPSCGDTSQCGQC-SANRNYLFACQSRGIFQMCYGATRPTGQFGYCPTGTVCDAS 135

  Fly   131 SGKYCVDLCEV-GDSVECDRDSPL 153
            |...||.  || |.::.||.:..|
  Fly   136 STAICVP--EVAGQTLTCDINDEL 157



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4871827
eggNOG 1 0.900 E1_2F9QR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.