DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13311 and CG13075

Sequence 1:NP_648258.1 Gene:CG13311 FlyBaseID:FBgn0035929 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_648831.1 Gene:CG13075 FlyBaseID:FBgn0036563 Length:339 Species:Drosophila melanogaster

Alignment Length:145 Identity:38/146 (26%)
Similarity:66/146 (45%) Gaps:20/146 (14%)


  Fly    15 VVSSMAVLVQGV-------CNSC-QANNVKCLNETHYSFCSDNVAPNQVLQCPDNKVCTDLAIIC 71
            :::.:|::..|:       |.:| :.|:|.|:::..|..|..|.....:::||...||::...:|
  Fly     4 IIALVAIMACGLSFVAAQSCQTCLEQNDVYCVDQNSYQNCMKNGPVGDIIECPSGTVCSNSDSVC 68

  Fly    72 MDSSVVDSS----CSGTA--DGSCPTCDGNSMFVCTSRTTFQMCD--GTNLTGQVTKCKDNKICS 128
            ...|.|:|:    |.|:.  ...|..|...:.:.|.|.|.:..|.  |..||..|..|..::||.
  Fly    69 ALISEVNSTILDVCGGSGGNGAQCEVCSSGAKYACVSSTQYARCSSAGDVLTSSVYNCGTDEICI 133

  Fly   129 IKS-GKY---CVDLC 139
            |.: ..|   ||..|
  Fly   134 IDALSTYQTVCVPSC 148



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4872183
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.