DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13311 and CG13075

DIOPT Version :9

Sequence 1:NP_648258.1 Gene:CG13311 / 39008 FlyBaseID:FBgn0035929 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_648831.1 Gene:CG13075 / 39756 FlyBaseID:FBgn0036563 Length:339 Species:Drosophila melanogaster


Alignment Length:145 Identity:38/145 - (26%)
Similarity:66/145 - (45%) Gaps:20/145 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VVSSMAVLVQGV-------CNSC-QANNVKCLNETHYSFCSDNVAPNQVLQCPDNKVCTDLAIIC 71
            :::.:|::..|:       |.:| :.|:|.|:::..|..|..|.....:::||...||::...:|
  Fly     4 IIALVAIMACGLSFVAAQSCQTCLEQNDVYCVDQNSYQNCMKNGPVGDIIECPSGTVCSNSDSVC 68

  Fly    72 MDSSVVDSS----CSGTA--DGSCPTCDGNSMFVCTSRTTFQMCD--GTNLTGQVTKCKDNKICS 128
            ...|.|:|:    |.|:.  ...|..|...:.:.|.|.|.:..|.  |..||..|..|..::||.
  Fly    69 ALISEVNSTILDVCGGSGGNGAQCEVCSSGAKYACVSSTQYARCSSAGDVLTSSVYNCGTDEICI 133

  Fly   129 IKS-GKY---CVDLC 139
            |.: ..|   ||..|
  Fly   134 IDALSTYQTVCVPSC 148



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.