DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13311 and CG13308

Sequence 1:NP_648258.1 Gene:CG13311 FlyBaseID:FBgn0035929 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_648261.2 Gene:CG13308 FlyBaseID:FBgn0035932 Length:233 Species:Drosophila melanogaster

Alignment Length:151 Identity:44/152 (29%)
Similarity:67/152 (44%) Gaps:13/152 (9%)


  Fly     6 ILRNLCLIVVVSSMAVLVQGV---CNSC-QANNVKCLNETHYSFCSDNVAP-NQVLQCPDNKVCT 65
            :||.|.|:.:...:.:.:.|:   ||.| ..:||.|::.|.:.|||.:..| ..|..||....||
  Fly     1 MLRCLILLAIGVFLVIRILGIRGDCNVCASVSNVACISNTSFQFCSSSALPAGPVYTCPTGYYCT 65

  Fly    66 DLAIICMDSSVVDSSCSGTADGSCPTCDGNSMFVCTSRTTFQMCDGTNLTGQVT-KCKDNKICSI 129
            ...:.| ::.|...||.|     |.|||..:.|.|.:..||.:|.||:...|:. .|..:.:|..
  Fly    66 ANDVTC-NTDVAQRSCIG-----CGTCDSGNTFACLTARTFALCLGTSTPSQIVGSCGSSYVCDF 124

  Fly   130 KSGKYCVDLCEVGDSVECDRD 150
            .:...|.... .|....|..|
  Fly   125 NNPYICGSPA-AGSQATCPGD 144



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4872041
eggNOG 1 0.900 E1_2F9QR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.