DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13311 and CG13312

Sequence 1:NP_648258.1 Gene:CG13311 FlyBaseID:FBgn0035929 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_648260.1 Gene:CG13312 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster

Alignment Length:130 Identity:35/131 (27%)
Similarity:53/131 (40%) Gaps:9/131 (7%)


  Fly    12 LIVVVSSMAVLVQGVCNSCQ-ANNVKCLNETHYSFCS-DNVAPNQVLQCPDNKVCT--DLAIICM 72
            |:.::..:.....|.||.|. .||:.|.:.|....|. |.::......||...||.  ...::|.
  Fly    15 LLFLLGCLVSSTHGTCNVCNTVNNLTCYSSTQMQSCQVDVLSTATPTDCPSGYVCVSGSSGVLCQ 79

  Fly    73 DSSVVDSSCSGTAD-GSCPTCDGNSMFVCTSRTTFQMCDGTN-LTGQVTKCKDNKICSIKSGKYC 135
            ..   ||:....|| ..|..||....|.||...:|.:|.||: :...|..|....:|:|...:.|
  Fly    80 PE---DSASDSQADCQECNKCDETQTFACTGTQSFALCLGTDTVQDSVGTCASGYVCNINDTQIC 141

  Fly   136  135
              Fly   142  141



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4872149
eggNOG 1 0.900 E1_2F9QR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.