DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13311 and CG33258

DIOPT Version :10

Sequence 1:NP_648258.1 Gene:CG13311 / 39008 FlyBaseID:FBgn0035929 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001034027.2 Gene:CG33258 / 3885664 FlyBaseID:FBgn0053258 Length:252 Species:Drosophila melanogaster


Alignment Length:140 Identity:40/140 - (28%)
Similarity:66/140 - (47%) Gaps:11/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCLIVVVSSMAVLVQGVCNSC-QANNVKCLNETHYSFCSDNVAPNQVLQCPDNKVCTDLAIICMD 73
            |.|.:|...:|::....|..| :.|:|.|:::|.|..|..:.....|:.|||:.|||:...:|:.
  Fly     6 LILAIVFCGLAIVKALECQECLEDNDVYCVDQTSYRNCIKSKPFGNVISCPDDTVCTNSKNVCVK 70

  Fly    74 SSVVDSS----CSGTADGSCPTCDGNSMFVCTSRTTFQMC-DGTNLTGQVTKCKDNKICSIKS-G 132
            ||.:..|    |..:....|.||. |..:.|.|:..|..| :...:...:..|..::|||.:: .
  Fly    71 SSDLAESEVDVCGTSGGNQCATCT-NQKYTCVSKNQFARCSESVVVDSNIYDCDTDEICSSEALE 134

  Fly   133 KY---CVDLC 139
            ||   |...|
  Fly   135 KYDNICTPSC 144

Return to query results.
Submit another query.