DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13311 and CG33258

Sequence 1:NP_648258.1 Gene:CG13311 FlyBaseID:FBgn0035929 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001034027.2 Gene:CG33258 FlyBaseID:FBgn0053258 Length:252 Species:Drosophila melanogaster

Alignment Length:140 Identity:40/141 (28%)
Similarity:66/141 (47%) Gaps:11/141 (8%)


  Fly    10 LCLIVVVSSMAVLVQGVCNSC-QANNVKCLNETHYSFCSDNVAPNQVLQCPDNKVCTDLAIICMD 73
            |.|.:|...:|::....|..| :.|:|.|:::|.|..|..:.....|:.|||:.|||:...:|:.
  Fly     6 LILAIVFCGLAIVKALECQECLEDNDVYCVDQTSYRNCIKSKPFGNVISCPDDTVCTNSKNVCVK 70

  Fly    74 SSVVDSS----CSGTADGSCPTCDGNSMFVCTSRTTFQMC-DGTNLTGQVTKCKDNKICSIKS-G 132
            ||.:..|    |..:....|.||. |..:.|.|:..|..| :...:...:..|..::|||.:: .
  Fly    71 SSDLAESEVDVCGTSGGNQCATCT-NQKYTCVSKNQFARCSESVVVDSNIYDCDTDEICSSEALE 134

  Fly   133 KY---CVDLC 139
            ||   |...|
  Fly   135 KYDNICTPSC 144



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4872077
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.