Sequence 1: | NP_648258.1 | Gene: | CG13311 / 39008 | FlyBaseID: | FBgn0035929 | Length: | 153 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034027.2 | Gene: | CG33258 / 3885664 | FlyBaseID: | FBgn0053258 | Length: | 252 | Species: | Drosophila melanogaster |
Alignment Length: | 140 | Identity: | 40/140 - (28%) |
---|---|---|---|
Similarity: | 66/140 - (47%) | Gaps: | 11/140 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 LCLIVVVSSMAVLVQGVCNSC-QANNVKCLNETHYSFCSDNVAPNQVLQCPDNKVCTDLAIICMD 73
Fly 74 SSVVDSS----CSGTADGSCPTCDGNSMFVCTSRTTFQMC-DGTNLTGQVTKCKDNKICSIKS-G 132
Fly 133 KY---CVDLC 139 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45471625 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005298 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |