DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13311 and CG32024

Sequence 1:NP_648258.1 Gene:CG13311 FlyBaseID:FBgn0035929 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_729417.2 Gene:CG32024 FlyBaseID:FBgn0052024 Length:209 Species:Drosophila melanogaster

Alignment Length:144 Identity:49/145 (34%)
Similarity:67/145 (46%) Gaps:13/145 (9%)


  Fly    12 LIVVVSSMAVLV---QGVCNSCQA-NNVKCLNETHYSFCSDNVAP-NQVLQCPDNKVCTDLAIIC 71
            |:..|..:|.||   |..||.|.: :||.|:::..|..||.|..| ..|..||:|..||.|...|
  Fly     5 LLFSVFLLATLVKFSQAECNICSSESNVACVSKNQYQNCSANAIPTGTVYTCPNNTFCTGLPEKC 69

  Fly    72 MDSSVVDSSCSGTADGSCPTCDGNSMFVCTSRTTFQMCDGTN-LTGQVTKCKDNKICSIKSGKYC 135
             .|:...:||:     .|..|||...|.|||.|||.:|:..| :......|...::|..:.|..|
  Fly    70 -TSNEAFASCN-----DCRKCDGIIPFACTSPTTFALCNAVNEIASNEYPCSTGEVCLYQIGNPC 128

  Fly   136 VDLCEVGDSVECDR 149
            | ....|.|..|.:
  Fly   129 V-ASPNGTSASCSQ 141



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4872006
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.