DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13311 and CG32023

DIOPT Version :9

Sequence 1:NP_648258.1 Gene:CG13311 / 39008 FlyBaseID:FBgn0035929 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_729415.2 Gene:CG32023 / 317827 FlyBaseID:FBgn0052023 Length:160 Species:Drosophila melanogaster


Alignment Length:158 Identity:94/158 - (59%)
Similarity:113/158 - (71%) Gaps:5/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQQSQILRNLCLIVVVSSMAVLVQG--VCNSCQANNVKCLNETHYSFCSDNVAPNQVLQCPDNKV 63
            ||.:|:||.||.||::|.|||.|.|  .||.||.|:||||||||:|||.|.|:.:||:||||.:|
  Fly     1 MQYTQLLRVLCSIVIISYMAVHVLGDIKCNVCQPNHVKCLNETHFSFCLDAVSSDQVIQCPDGQV 65

  Fly    64 CTDLAIICMDSSVVDSSCSGTADGSCPTCDGNSMFVCTSRTTFQMCDGTNLTGQVTKCKDNKICS 128
            ||.|..||:......:||:..|:.|||.|.|..:|||||||||||||...|.|||||||||..||
  Fly    66 CTSLLKICLPKGSTPASCTPDAEISCPPCSGAGLFVCTSRTTFQMCDEGKLIGQVTKCKDNTFCS 130

  Fly   129 IKSGKYCVDLCEVGDS---VECDRDSPL 153
            :||.|:|||.||:..|   .||||:|||
  Fly   131 MKSKKFCVDQCEITKSQNGFECDRESPL 158



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471589
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9QR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.