DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13311 and CG32023

Sequence 1:NP_648258.1 Gene:CG13311 FlyBaseID:FBgn0035929 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_729415.2 Gene:CG32023 FlyBaseID:FBgn0052023 Length:160 Species:Drosophila melanogaster

Alignment Length:158 Identity:94/159 (59%)
Similarity:113/159 (71%) Gaps:5/159 (3%)


  Fly     1 MQQSQILRNLCLIVVVSSMAVLVQG--VCNSCQANNVKCLNETHYSFCSDNVAPNQVLQCPDNKV 63
            ||.:|:||.||.||::|.|||.|.|  .||.||.|:||||||||:|||.|.|:.:||:||||.:|
  Fly     1 MQYTQLLRVLCSIVIISYMAVHVLGDIKCNVCQPNHVKCLNETHFSFCLDAVSSDQVIQCPDGQV 65

  Fly    64 CTDLAIICMDSSVVDSSCSGTADGSCPTCDGNSMFVCTSRTTFQMCDGTNLTGQVTKCKDNKICS 128
            ||.|..||:......:||:..|:.|||.|.|..:|||||||||||||...|.|||||||||..||
  Fly    66 CTSLLKICLPKGSTPASCTPDAEISCPPCSGAGLFVCTSRTTFQMCDEGKLIGQVTKCKDNTFCS 130

  Fly   129 IKSGKYCVDLCEVGDS---VECDRDSPL 153
            :||.|:|||.||:..|   .||||:|||
  Fly   131 MKSKKFCVDQCEITKSQNGFECDRESPL 158



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4871813
eggNOG 1 0.900 E1_2F9QR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.