DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GAPsec and TBC1D5

Sequence 1:NP_648245.2 Gene:GAPsec FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_731780.1 Gene:TBC1D5 FlyBaseID:FBgn0038129 Length:654 Species:Drosophila melanogaster

Alignment Length:421 Identity:107/422 (25%)
Similarity:176/422 (42%) Gaps:126/422 (30%)


  Fly    23 DLKQLRKLAFNGVPDVQSFRALSWKLLLGYLGPRRSSWTTTLAQKRALYKQFIEELVLPPGHSSN 87
            |.:.||:.||.|...:..||::.|.|||..|.....|||:...|:|..|.:|..:.|..|    :
  Fly    58 DPESLRQSAFAGDLKMSKFRSVHWALLLRVLTSEHRSWTSQRLQQRVRYDKFRADYVRNP----H 118

  Fly    88 RASVDGGDGDKVDSGGVGLQDHPLSEGPESAWNTFFNDNEFLLQIDKDVRRLCPDISFFQQPTDY 152
            :.:||             ..|.|||:..:|.||.:|:|.:....|.:||.|..|.:.||::|.  
  Fly   119 QLAVD-------------CNDDPLSQSTQSVWNQYFSDQDLFAVIRQDVVRTFPGVDFFRKPL-- 168

  Fly   153 PCEIVVHSKGEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVV 217
                                                           |:|             .:
  Fly   169 -----------------------------------------------VQN-------------AM 173

  Fly   218 QRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDP-------------------DLTYRAHAEAD 263
            ..|||.||:.:|...|.|||:||:.||.:|:.||.                   |:...|:.|||
  Fly   174 VNILFYYAREHPYMCYRQGMHEILAPIIFVVYSDHQSLLHFSELAKTDINPTLLDVLDPAYLEAD 238

  Fly   264 CFFCFTALMSEIRDFF----------------------IKTLDDAE--GGIKFMMARLSNMLKSK 304
            .:..|:.||:.:..::                      .:|..:||  |.:.|:..::   |..:
  Fly   239 TYSLFSRLMASVESYYRVSNLVSTPGGHIEQRAESPGDNETSTEAEVIGQLNFIRDKI---LAKQ 300

  Fly   305 DLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKICCSMILIQR 369
            |..::..|:..|:....:..|||.||..:||.|.|:|.:||::|||..|||....|..:|::..|
  Fly   301 DQHLHHYLQKMEIPLHIFGIRWLRLLFGREFMLLDLLLLWDAIFADSDRFDLPNYILVAMLVHIR 365

  Fly   370 EAILENDFASNVKLLQNYP-PIDINVVIAHA 399
            :.:|.:|:.:::..|..|| .:|:::|:.||
  Fly   366 DKLLLSDYTTSLTYLMRYPNNVDVHLVLRHA 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 57/225 (25%)
TBC1D5NP_731780.1 TBC <150..369 CDD:214540 65/284 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C22235285
eggNOG 1 0.900 E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22957
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.