| Sequence 1: | NP_648237.1 | Gene: | GstO1 / 38975 | FlyBaseID: | FBgn0035907 | Length: | 254 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_015277.1 | Gene: | CAM1 / 856059 | SGDID: | S000005969 | Length: | 415 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 56 | Identity: | 15/56 - (26%) |
|---|---|---|---|
| Similarity: | 23/56 - (41%) | Gaps: | 21/56 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 60 WFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEK 115 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstO1 | NP_648237.1 | Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold | 3..95 | CDD:469754 | 7/34 (21%) |
| GST_C_Omega | 109..234 | CDD:198293 | 3/7 (43%) | ||
| CAM1 | NP_015277.1 | GST_N_EF1Bgamma | 4..73 | CDD:239342 | |
| GST_C_EF1Bgamma_like | 92..214 | CDD:198290 | 9/41 (22%) | ||
| EF1G | 255..359 | CDD:459888 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||