DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstD5

DIOPT Version :10

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:164 Identity:39/164 - (23%)
Similarity:69/164 - (42%) Gaps:34/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KPEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKY-PEVPLYPKDLLKKA--QEKILI 118
            |||:..|....| :|.|   .:.|..:. ||..|..||.||| .:..|:|||..|:|  .:::..
  Fly    40 KPEFVKLNPQHT-IPTL---VDNGFSIW-ESRAIAVYLVE
KYGKDDTLFPKDPKKQALVNQRLYF 99

  Fly   119 ERFGQFINAF---YYLLLH-------DNPEQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLD 173
            : .|...::|   ||.|.|       ::.:::..:..|..:.:..:       .:..||...:.|
  Fly   100 D-MGTLYDSFAKYYYPLFHTGKPGSDEDFKKIESSFEYLNIFLEGQ-------NYVAGDHLTVAD 156

  Fly   174 YMMWPWCERFDSLKYTFEQKFELSPERFPTLIKW 207
            ..:.       |...||| .|:....::|.:.:|
  Fly   157 IAIL-------STVSTFE-IFDFDLNKYPNVARW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 12/37 (32%)
GST_C_Omega 109..234 CDD:198293 19/111 (17%)
GstD5NP_524914.3 GST_N_Delta_Epsilon 1..74 CDD:239343 13/38 (34%)
GST_C_Delta_Epsilon 88..204 CDD:198287 19/111 (17%)

Return to query results.
Submit another query.