DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and Clic6

DIOPT Version :10

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:259 Identity:51/259 - (19%)
Similarity:99/259 - (38%) Gaps:77/259 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPALEL---VKEQGNPV---LIESL 88
            ||::.|:.::|..|.:.::...::|:.||.....::..|..|.:..   ||...|.:   |.|.|
  Rat   396 CPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKL 460

  Fly    89 IICDY--LDEKYPEV-----------------------PLYPKDLLKKAQEKILIERFGQFINAF 128
            :...|  |..::||.                       .:|.|:||:      .:::...::|: 
  Rat   461 VPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANDIYEKNLLR------ALKKLDSYLNS- 518

  Fly   129 YYLLLHDNPEQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCE--RFDSLKYTFE 191
                  ..|:::   |.|:     .|::.....||..||...:.|..:.|...  :..:.||   
  Rat   519 ------PLPDEI---DAYS-----TEDVTVSQRKFLDGDELTLADCNLLPKLHIIKIVAKKY--- 566

  Fly   192 QKFELSPERFPTLIK--WRDLMIQDRAVKCFYL-DGQTHAKYMNSRRSGQADYNMLYNEAKRVK 252
            :.||     ||:.:.  ||            || :.....::.|:..:.|...:...:.|||:|
  Rat   567 RGFE-----FPSEMTGIWR------------YLNNAYARDEFTNTCPADQEIEHAYSDAAKRMK 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 17/72 (24%)
GST_C_Omega 109..234 CDD:198293 23/129 (18%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 50/257 (19%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 396..399 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.