DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstE9

DIOPT Version :10

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:218 Identity:55/218 - (25%)
Similarity:82/218 - (37%) Gaps:53/218 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINL---RDKPEWFSLVSSSTKVPALELVKEQGN 81
            |.|.||.:...|......|.|||..:.|....:||   ..|.:.|||.:....||.||   :.|.
  Fly     2 GKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLE---DDGK 63

  Fly    82 PVLIESLIICDYLDEKYPEV-PLYPKDLLKKAQEKILIERFGQFINA-------------FYYLL 132
             .:.||..||.||..:|.:. .|||||..|:|    |:::...|.:.             .:|..
  Fly    64 -FIWESHAICAYLVRRYAKSDDLYPKDYFKRA----LVDQRLHFESGVLFQGCIRNIAIPLFYKN 123

  Fly   133 LHDNPEQLVDTDHYAGLVVYE--EELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFE 195
            :.:.|...:|       .:||  :.|:    .|.|..:     |:..|.....|   |:......
  Fly   124 ITEVPRSQID-------AIYEAYDFLE----AFIGNQA-----YLCGPVITIAD---YSVVSSVS 169

  Fly   196 -------LSPERFPTLIKWRDLM 211
                   :..:|:|.|..|.|.|
  Fly   170 SLVGLAAIDAKRYPKLNGWLDRM 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 26/77 (34%)
GST_C_Omega 109..234 CDD:198293 22/125 (18%)
GstE9NP_725784.1 GstA 4..199 CDD:440390 54/216 (25%)

Return to query results.
Submit another query.