DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTZ1

DIOPT Version :10

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_973400.1 Gene:GSTZ1 / 814770 AraportID:AT2G02390 Length:228 Species:Arabidopsis thaliana


Alignment Length:101 Identity:34/101 - (33%)
Similarity:51/101 - (50%) Gaps:14/101 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEW----------LVEVSPLLKVPALQLV 76
            |:|||......|.|..:.|..|.:.|..:.:||.:..::          ..:::|:..||||   
plant     9 LKLYSYWRSSCAHRVRIALALKGLDYEYIPVNLLKGDQFDSVYRFDLQDFKKINPMGTVPAL--- 70

  Fly    77 AEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRA 112
             ..|:..:.:|..|..|||:||||.||||:|..|||
plant    71 -VDGDVVINDSFAIIMYLDEKYPEPPLLPRDLHKRA 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 20/82 (24%)
GST_C_Omega 109..230 CDD:198293 3/4 (75%)
GSTZ1NP_973400.1 maiA 10..224 CDD:273527 33/100 (33%)

Return to query results.
Submit another query.