DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6683 and Adf1

Sequence 1:NP_648232.1 Gene:CG6683 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster

Alignment Length:152 Identity:50/153 (33%)
Similarity:62/153 (41%) Gaps:17/153 (11%)


  Fly     3 QFDTRLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRRE 67
            |||..|||.|:.||.:|:|...|  |: |..|..:.|..||.:|......|..||..|..|..||
  Fly    11 QFDLNLIEAVKLNPVIYDRSHYN--YK-HFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFARE 72

  Fly    68 --LAKEKAGGTGSDWSLLPHLKFLQHHHHPINHRNSGDLSRSTLKSSDEVNDDEDPLQEAMDEQL 130
              |.:|      |.|.....::||.....  .:|.|  |.......|...|...||.|:...:|.
  Fly    73 MKLCQE------SRWRYFKQMQFLVDSIR--QYRES--LLGKCANGSQSANQVADPSQQQQAQQQ 127

  Fly   131 AVAGAAPAPPTNPAHATPVAQA 152
            .|.... |.|.| ..||..|||
  Fly   128 TVVDIF-AQPFN-GSATTSAQA 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6683NP_648232.1 MADF 7..94 CDD:214738 29/89 (33%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2E5JB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.