DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6683 and jigr1

Sequence 1:NP_648232.1 Gene:CG6683 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster

Alignment Length:312 Identity:60/313 (19%)
Similarity:95/313 (30%) Gaps:136/313 (43%)


  Fly     3 QFDTRLIELVRANPKLYER---ELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQ 64
            :||..||...|::|.||:|   ..::..|.||      ||..||..|..:|::...|...|  :.
  Fly    28 EFDLGLIREYRSHPVLYDRSNKRFKDKLYVAH------IWEQIAHKLGYDATSIRERMTTL--RN 84

  Fly    65 RRELAKEKA----GGTGSDWSLLPHLKFLQHHHHP--------------------------INHR 99
            |..:.|.:.    ....|.|.|...|:||..|..|                          ..|.
  Fly    85 RYNIEKRRVENGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMSVKEEDEETYEVDDCRSDSNGHM 149

  Fly   100 NS--GDLSRST------------------LKSSDEVND--------------------------- 117
            ||  .:|...:                  |.:|||.|.                           
  Fly   150 NSIKDELEDDSEIFDCEQALPVTTVLGIPLNNSDEANKSQRSTNGEMPNGKGYNHFAESYHRRHQ 214

  Fly   118 -------------------------DEDPLQEAMDEQLAVAGAAPAPPTNPAHATPVAQAEKRIE 157
                                     |:.|.:..:|:.|:::|..|..|..|   .|.|.|:.|  
  Fly   215 NQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRRVDDSLSISGYYPTQPLAP---LPPAYAKFR-- 274

  Fly   158 ALLEGLGE-----------ANRIKAEKRILAYLCKCNLR---ALNDEQIDDI 195
                |.||           |..::..::....|.:.:||   :.:.|:.|::
  Fly   275 ----GFGEFMCHSLCDMPAATALRLVQKFTRELVQSSLRNEDSGSKEKTDEV 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6683NP_648232.1 MADF 7..94 CDD:214738 27/94 (29%)
jigr1NP_001097920.1 MADF 33..118 CDD:214738 27/93 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.