DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6683 and CG12768

Sequence 1:NP_648232.1 Gene:CG6683 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001262229.1 Gene:CG12768 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster

Alignment Length:167 Identity:46/168 (27%)
Similarity:65/168 (39%) Gaps:27/168 (16%)


  Fly     7 RLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRRELAKE 71
            |||||||.||.|::..|.:  |:...||....|:.:....|.........:..|....||||..|
  Fly    12 RLIELVRLNPILWDCRLPH--YKRSDKRKAIKWNELGRLFNVNGERVQRTFTSLREIFRRELNHE 74

  Fly    72 KAGGT---GSDWSLLPHLKFLQHHHHPINHRNS------GDLSRSTLKSSDEVND---------D 118
            |..||   .|.|.....:.||:   ..|..|.|      |.|..:.:.:....|:         :
  Fly    75 KMLGTTRFKSKWEYYDAMAFLK---EVIRERKSRERIKHGSLDSAPVATGSSNNNNNCVSRNSSN 136

  Fly   119 EDPLQEAMDEQLAVAGAAPAPPTNPAHATPVAQAEKR 155
            .:....|:||....   ||:.|.|| :..|..|.|.:
  Fly   137 NNSSSAALDEYQYF---APSDPNNP-NNQPQLQPEPK 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6683NP_648232.1 MADF 7..94 CDD:214738 29/90 (32%)
CG12768NP_001262229.1 MADF 12..100 CDD:214738 30/93 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.