DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6683 and hng1

Sequence 1:NP_648232.1 Gene:CG6683 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster

Alignment Length:301 Identity:63/302 (21%)
Similarity:85/302 (28%) Gaps:132/302 (44%)


  Fly     5 DTRLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRRELA 69
            |..||:.:|..|.||:.:|   |.....:|..|.|:.:|..||...|....||..|..:..|||.
  Fly    12 DILLIQTIRETPSLYDPQL---PSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSRELK 73

  Fly    70 KEKAGGTGSDWSLLPHLKF-----------------------------------LQHHHH---PI 96
            :::...:|.    ..|..|                                   ||....   ||
  Fly    74 QKRLHPSGE----FGHNDFFRKMDFLRDFVRKRRERRGRERDREQKPTGWMKVDLQRRRRTRLPI 134

  Fly    97 N-------------------HRNSGDLSRSTLKSSD-----EVNDDEDPLQEAMDE--------- 128
            :                   |.....|...|.:|..     |.:|.::|.||:.||         
  Fly   135 DTETLIEEQGSHAYDEGEEQHDYDAKLESHTTQSETYSVVVEADDGQEPEQESFDEFLGDAECEQ 199

  Fly   129 ---------QLAVAGAAPAP-PTNPAHA--------TPVAQAE---------------------- 153
                     ::|...|..|| |....||        .|.|..|                      
  Fly   200 KVKVVTIHPEIAAPNATSAPEPIESNHADLNYLVCMPPNANQEREHSAPELPNPTAVITQKTCET 264

  Fly   154 ------KRIEALLEGLGEANRIKA--------EKRILAYLC 180
                  |.|.|.|..|...::|||        ||.||...|
  Fly   265 EDDFFCKSIAAYLRQLSRVHKIKAKVEMYQILEKYILLEEC 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6683NP_648232.1 MADF 7..94 CDD:214738 26/122 (21%)
hng1NP_611558.2 MADF 15..98 CDD:214738 24/90 (27%)
BESS 264..298 CDD:281011 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.