powered by:
Protein Alignment CG6683 and Coop
DIOPT Version :9
| Sequence 1: | NP_648232.1 |
Gene: | CG6683 / 38970 |
FlyBaseID: | FBgn0035902 |
Length: | 197 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001260776.1 |
Gene: | Coop / 35677 |
FlyBaseID: | FBgn0263240 |
Length: | 358 |
Species: | Drosophila melanogaster |
| Alignment Length: | 107 |
Identity: | 28/107 - (26%) |
| Similarity: | 42/107 - (39%) |
Gaps: | 11/107 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 RLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRRELAKE 71
|||..|...|.|: |||......:.....:|..:...:|..|..|..:|.||....|:...:.
Fly 42 RLIAAVSRRPMLW---LRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVYIRN 103
Fly 72 K-AGGTGSDWSLLPHLKFLQHHHHPINHRNSGDLSRSTLKSS 112
. :..|.|.|.....::|:: |..|.| :.|.|..||
Fly 104 NLSNETPSSWRFYNDMRFME----PAVHEN---IMRQTRSSS 138
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG6683 | NP_648232.1 |
MADF |
7..94 |
CDD:214738 |
21/87 (24%) |
| Coop | NP_001260776.1 |
MADF |
42..124 |
CDD:214738 |
21/88 (24%) |
| BESS |
320..353 |
CDD:281011 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0009996 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR12243 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.