DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6683 and Coop

DIOPT Version :10

Sequence 1:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_610286.2 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster


Alignment Length:107 Identity:28/107 - (26%)
Similarity:42/107 - (39%) Gaps:11/107 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRRELAKE 71
            |||..|...|.|:   |||......:.....:|..:...:|..|..|..:|.||....|:...:.
  Fly    42 RLIAAVSRRPMLW---LRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVYIRN 103

  Fly    72 K-AGGTGSDWSLLPHLKFLQHHHHPINHRNSGDLSRSTLKSS 112
            . :..|.|.|.....::|::    |..|.|   :.|.|..||
  Fly   104 NLSNETPSSWRFYNDMRFME----PAVHEN---IMRQTRSSS 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6683NP_648232.1 MADF 7..94 CDD:214738 21/87 (24%)
CoopNP_610286.2 MADF 42..124 CDD:214738 21/88 (24%)
BESS 320..353 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.