DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6683 and CG4404

DIOPT Version :9

Sequence 1:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster


Alignment Length:148 Identity:33/148 - (22%)
Similarity:56/148 - (37%) Gaps:29/148 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDTRLIELVRANPKLYERELRNAPYEAHKKRH--PEIWSSIATSLNSEASACVSRWNHLVAKQRR 66
            |:.|.::.|...|.|:     |..:..:.|:.  ...|..:|..:......|..||..:.:...|
  Fly    14 FNVRFVQFVENQPCLW-----NYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLR 73

  Fly    67 --ELAKEKAGGTGSDWSLLPHLKFLQ--------HHHHP-INHRNSGDLSRSTLKSSDE------ 114
              :||:.:.|.....:.|..:|:||.        |...| :..|..|  ..:|.:..||      
  Fly    74 SLKLARTQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPG--QAATAQQEDEVVAAEE 136

  Fly   115 ---VNDDEDPLQEAMDEQ 129
               |:|.|.||...:.|:
  Fly   137 EAKVSDGEMPLDVQVSEE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6683NP_648232.1 MADF 7..94 CDD:214738 20/98 (20%)
CG4404NP_572838.2 MADF 17..103 CDD:214738 19/90 (21%)
BESS 267..301 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.