DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6683 and CG4404

DIOPT Version :10

Sequence 1:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster


Alignment Length:148 Identity:33/148 - (22%)
Similarity:56/148 - (37%) Gaps:29/148 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDTRLIELVRANPKLYERELRNAPYEAHKKRH--PEIWSSIATSLNSEASACVSRWNHLVAKQRR 66
            |:.|.::.|...|.|:     |..:..:.|:.  ...|..:|..:......|..||..:.:...|
  Fly    14 FNVRFVQFVENQPCLW-----NYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLR 73

  Fly    67 --ELAKEKAGGTGSDWSLLPHLKFLQ--------HHHHP-INHRNSGDLSRSTLKSSDE------ 114
              :||:.:.|.....:.|..:|:||.        |...| :..|..|  ..:|.:..||      
  Fly    74 SLKLARTQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPG--QAATAQQEDEVVAAEE 136

  Fly   115 ---VNDDEDPLQEAMDEQ 129
               |:|.|.||...:.|:
  Fly   137 EAKVSDGEMPLDVQVSEE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6683NP_648232.1 MADF 7..94 CDD:214738 20/98 (20%)
CG4404NP_572838.2 MADF 17..103 CDD:214738 19/90 (21%)
BESS 267..301 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.