DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6683 and si:zfos-128g4.1

Sequence 1:NP_648232.1 Gene:CG6683 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_002661969.1 Gene:si:zfos-128g4.1 ZFINID:ZDB-GENE-141212-382 Length:248 Species:Danio rerio

Alignment Length:180 Identity:50/181 (28%)
Similarity:78/181 (43%) Gaps:35/181 (19%)


  Fly     7 RLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHL---VAKQRR-- 66
            :||:.|.|.|.||...|.:  |.:.::| .:.|..:|.|:......|..||..:   ..::||  
Zfish     8 KLIQTVYAFPVLYNVSLHD--YRSTERR-VKAWREVAASVGLSVVECKRRWKTIRDRYIRERRLC 69

  Fly    67 ELAKEKAGGTGSDWSLLPH---LKFLQHHHHPINHRNSG----DLSRSTLKSSDEVNDDEDPL-Q 123
            :|.|:..|.....|   ||   |.||..|... ..|.||    :..:....||..:.:|::.: :
Zfish    70 KLKKDLGGRRLHYW---PHRESLAFLDAHIRK-RRRPSGAQGPEEEQQEEHSSAALQEDKECVSE 130

  Fly   124 EAMD--EQLAVAG------AAPAPPTNPA--HATPVAQAEKRIEALLEGL 163
            |.:|  .:|||:.      :||.||...|  ..:|:..|     ||..||
Zfish   131 ECVDSGSRLAVSPLPVSIMSAPPPPQLKAVPQVSPLLLA-----ALPPGL 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6683NP_648232.1 MADF 7..94 CDD:214738 28/95 (29%)
si:zfos-128g4.1XP_002661969.1 MADF 8..97 CDD:214738 28/95 (29%)
BESS 208..242 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.