DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Exo70 and exo70

DIOPT Version :8

Sequence 1:NP_648222.3 Gene:Exo70 / 38959 FlyBaseID:FBgn0266667 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_595170.2 Gene:exo70 / 2540127 PomBaseID:SPBC106.20 Length:615 Species:Schizosaccharomyces pombe

Alignment Length:739 Identity:152/740 (21%)
Similarity:268/740 (36%) Gaps:240/740 (32%)


  Fly    39 SSILTIFEKRLGNLEQTILPVYQETEQLQKRQQNLEATLNCLES---VLSHYDVSQ---EVCQLI 97
            |:||...:|||..||.:...:..:.....:...|:..||..:||   :.||..|.|   :.||.:
pombe    31 SNILLSMDKRLSGLEASAGILRDDVTNYNRVSSNIYDTLKEMESLQVIHSHLPVLQKGLQECQNL 95

  Fly    98 HQGPVEGNISVFLDALAKLRDANDY---------FRHNNSQSVELENVTSLFNTGCEGLSQHYSM 153
            ::. |..|:...:|.|..|  |.||         |...:.|.||:     :.:.||:.|......
pombe    96 NKS-VSQNLKSVMDILKSL--AEDYTSLEGSPLQFASKSQQKVEM-----MLSEGCQILGALCYN 152

  Fly   154 LLKKHSAPL--KPVELLDLIY---IEDDSSDEYTSFRQLSQTTREELYTISHWLEQNLREYTNIY 213
            :|:.::|..  |...||||..   ..::|..::...  :.|...:.|:.:|     ...:.:|||
pombe   153 ILETYAASSLNKASTLLDLSIPWSFPNESLQQFIGL--IQQFDADVLFPVS-----CSSDISNIY 210

  Fly   214 ATERGEVVLRSLQLLKDHQKSNSWGHEALRPRHSGRQTEPKKTTSARLQQIFEKKANKLYLRATQ 278
            ...:||.|::.|.                             ..|.|..:|   |.|        
pombe   211 IKIKGECVVKLLH-----------------------------AVSMRTDEI---KLN-------- 235

  Fly   279 TIEQSTGFSIKKASSHSDHLTSEDLMDGDQELDKYLVMLLGLQRLLNWERAIMIDIIPQSKHNEV 343
              |.|..|...|          ||:.          :.|:.|.|||....:.::.:..|.....:
pombe   236 --EGSVNFVTGK----------EDVS----------INLVALSRLLPAVASELLLLFDQVTAKAL 278

  Fly   344 FATLAYNAIDLVVK------------------------DAEAITQRILRCISRKEWTSALGIFSA 384
            :..:...||:.|..                        |...:|::.:..:...|..|.||..:.
pombe   279 YPKIVKPAINTVTNATRQLEGVYEKRGAAENFVLLSLIDCIVVTRQNMNNLMPFEDASFLGFVNG 343

  Fly   385 LKRVI--LLQPDIDRTYD---------PAQREQLKKV-------LKKL-QHTGAKALEHFLDVVK 430
            :.|.:  :|...|.|.|:         |...:::.::       |.:| :|..|..|.       
pombe   344 VGREMEKILISSISRLYNGTCHNNKTVPLTTDRVSEMTHGIMSFLNELAEHENASYLL------- 401

  Fly   431 GESSTNIVGQSNVPKD----ATVHELTSNTIWFIEHLYDHFDVIGSILAQDVLYSTQLDTILMKK 491
             ||..|...:..:..|    .:|.::|.|.:         .|.:.|.|......:..:|||..|.
pombe   402 -ESIGNWGWRHEINADLSPARSVQDITRNYV---------MDCMDSYLTSVQTAAQAVDTIGWKM 456

  Fly   492 ALPVEERNKALLAIYIKKALAELNLSIM--NKCEQYNDQATKHLFRLNNIHYILKSLQRSNL--I 552
            .:.:                  ||:|:.  .||                    |:|...|.|  :
pombe   457 GVML------------------LNISVYFEAKC--------------------LESKIASFLQDV 483

  Fly   553 DLVTLAEPECEHS--YMEMIRE-----LKASYQKTWSKMLVGIYSLDELPKPVAGKVKDKDRSVL 610
            ||..|.:...::|  |||:.|:     |.::|.|:.:|                ..:..|:|.:.
pombe   484 DLEKLGDRSQKYSTMYMEVWRQCSQNMLDSTYTKSQNK----------------STMSAKEREIT 532

  Fly   611 KERFSNFNKD-------FEEACKIQRGISIPDVILREGIKRDNVEHILPIYNRFYEIYSGVHFSK 668
            ||:|.|||:.       ..|:.:.:.|::   ..|.:.:|:.    :||:|.|||:.|....|:|
pombe   533 KEKFRNFNEQVTSVVQVHRESVRFETGVA---TFLLQEVKKT----VLPLYQRFYDKYINSDFTK 590

  Fly   669 NPDKYVKYRQHEINAMLSKLFDDS 692
            |.|||:|:.:.::::.::..|..|
pombe   591 NKDKYIKFTKADLDSFITSAFAPS 614

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Exo70NP_648222.3 Exo70 315..686 CDD:281124 87/436 (20%)
exo70NP_595170.2 Exo70 253..609 CDD:281124 86/434 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I1691
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003002
OrthoInspector 1 1.000 T1125621
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12542
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3620
TreeFam 00.000 Not matched by this tool.
66.180

Return to query results.
Submit another query.