DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7120 and CG9988

Sequence 1:NP_001246667.1 Gene:CG7120 FlyBaseID:FBgn0035888 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_651625.1 Gene:CG9988 FlyBaseID:FBgn0039591 Length:668 Species:Drosophila melanogaster

Alignment Length:646 Identity:228/647 (35%)
Similarity:343/647 (53%) Gaps:72/647 (11%)


  Fly    97 ETNPSVP-------------KGFLVYSNSCRIMEVDPYKNEVMRHFKRIKYKSCQKLTPLTQVKF 148
            :||..:|             ..:.|.|..|:|..|||:.::.|..|....:::|...|.|....:
  Fly    44 DTNSDIPPAEEDRNVQDVVRPAYFVESAKCKIPYVDPFASDAMAIFHPEHFETCSNETALVTPIY 108

  Fly   149 EAKSQKYLLSIDG--AAFGRYPVGKQLHCCYMSVQR------VDEMKVKYTKCQTFKGSILLPDS 205
            :...|:|:|.|:.  |:......|.:.:|.|..:.|      .|:|:.||     |..:..:|..
  Fly   109 DISRQRYVLFINESLASIILNSNGGEYNCYYQEITRDRKHDSYDKMERKY-----FSQNYEVPLH 168

  Fly   206 AEGIIVKCDSGGRQIYINGHATVPVKEAVQQRLRMASEA-------------DAKGYQRPPSVLM 257
            .||:|:.|...|.:..|                 :.|:|             ..|..:|.|||||
  Fly   169 VEGLILTCHRLGNESDI-----------------LQSDAYNLIQYRPPPKGLSLKPSKRKPSVLM 216

  Fly   258 LGIDSISRVNLIRAMPKTAQYLYDNGWFELAGYNKVDDNTFPNIMAVLTGYNLPNAM-HACSPFV 321
            .||||:||:||.|.|||..::|..:||||..||||:.||||||::|:|||||..:|: ..|:...
  Fly   217 FGIDSLSRINLRRTMPKVYKFLTRDGWFEQQGYNKIGDNTFPNLLAILTGYNPESAIKKVCNWHE 281

  Fly   322 VGGLDKCDYIWKQYQQRGYVTAYAEDAVKINTFNYLKKGFKNPPADYYLRPYLSAAESQLDHTTV 386
            .|.||:..:||..::...|:||||||...||||||.|.||...|.|:||||...|.||.|:....
  Fly   282 DGCLDRTPFIWHYFRNASYLTAYAEDEAGINTFNYWKPGFLEQPTDFYLRPLQKAIESGLNTWKC 346

  Fly   387 N--GLVHCLGYLTAAEHVYDYGLEFTRRFLNE-TYFGFFWTNTHSHSDISQTSSMDSYMEEYLRK 448
            :  .:.:|:|....:.:.||....|..||::| ..:|.||:|:.||......|.|:.|:.:||..
  Fly   347 SDCSMKYCIGRRITSSYAYDMARNFANRFVDERPIWGLFWSNSFSHDSFQMPSKMEDYVLQYLLD 411

  Fly   449 LVRQGTMENTVVVFFSDHGMRFGPTRATWSGHLEERLPAIFIWLPQHLRRSHPQFVRSLQLNRNR 513
            ....|..:.:::||.||||.|:|...:..||.||||||::||:||...|..:|::.|:|:|||||
  Fly   412 FEADGVFDQSIMVFLSDHGSRYGRLMSLPSGFLEERLPSMFIYLPPWFRAQYPEYARALELNRNR 476

  Fly   514 LTTPYDLHLTMKHILAISGRAEMESLGPAPDCPQCQSLLTPVSPQRSCSDVGIADHWCTCWEYDT 578
            ||:.||||.|:|||:.:.|..:.::|..|.|||:||||..||...|||.|.||.:|:|||..|..
  Fly   477 LTSNYDLHNTLKHIIELGGTPDGQTLPKAADCPKCQSLFYPVDETRSCEDAGIPEHFCTCVPYKR 541

  Fly   579 ISSTSKESRMLGKRVVSYLNNYVAEFRNGTFAKLCAPLSLHSIK------SAFRAHHNALDPDEV 637
            :.  ::.::.:..:|:..:|.|:|. ||  .:|:|:.|:|..|.      ...:..|:.:...|:
  Fly   542 LD--TQWAKSIAPKVIGRINEYLAG-RN--LSKICSELTLSYIHLTEMKVELDQNFHDDVPRAEL 601

  Fly   638 HTYRLIFVTSPNKGQYEATLRHNHTDDSVKV-TGSVSRLNVYSGEADCMNDFAAKKYCYCR 697
            .|||.:|....|...:.||:..|:..|||:| ..::|||:.|...:.|:.|...|.||.|:
  Fly   602 GTYRTMFKVKQNSADFRATVIFNNVTDSVEVEVPTISRLDSYENVSTCVKDKTDKMYCICK 662

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7120NP_001246667.1 DUF229 130..622 CDD:281053 192/517 (37%)
ALP_like 253..528 CDD:293745 130/279 (47%)
CG9988NP_651625.1 DUF229 90..580 CDD:281053 192/517 (37%)
ALP_like 212..493 CDD:293745 130/281 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4914944
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.