DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7120 and CG14731

Sequence 1:NP_001246667.1 Gene:CG7120 FlyBaseID:FBgn0035888 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster

Alignment Length:705 Identity:181/706 (26%)
Similarity:297/706 (42%) Gaps:123/706 (17%)


  Fly    50 VSFTFCYFLIGRTGWVNVLDLDVLHSDNYVTVQHQSTV-MDVEPEPITETNPSVPKGFLVYSNSC 113
            :.::.|:..|.:..:..:|...:|    ||.:..:..| ..::.:|..|..|. .|...|.|:.|
  Fly     1 MGYSQCFVEIKKNSFRLILMCIIL----YVLINFREQVEHKMKEQPPIEGKPD-NKMLFVNSSQC 60

  Fly   114 RIMEVDPYKNEVMRHFKRIKYKSCQKLTPLTQVKFEAKSQKYLLSIDGAAFGRYPVGK--QLHCC 176
            :|..:||:....|.|...:...:|..:..:.....:..:..||::.....:.:..|.:  .:.|.
  Fly    61 QINSMDPFSPTAMYHMTPMPSSACPMIKLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSDIFCA 125

  Fly   177 YMSVQRVDEMKVKYTKCQTFKGSILLPDSAEGIIVKCDSG------------GRQIY-------- 221
            |....|.::....|.:...|:.|.|..      ..|.|||            ||.:|        
  Fly   126 YKRFVRFNDFVNIYFESTLFRFSKLRN------FTKVDSGNITLRVWCWMDYGRLVYHDVFIFLP 184

  Fly   222 ------INGHATVPVKEAVQQRLRMASEADAKGYQRPPSVLMLGIDSISRV----------NLIR 270
                  :|..|  |||     ||               |||:|||||||.:          :||.
  Fly   185 FPNPQKVNNSA--PVK-----RL---------------SVLILGIDSISHMHYQRYFSRVRDLIE 227

  Fly   271 AMPKTAQYLYDNGWFELAGYNKVDDNTFPNIMAVLTGYNLP--NAMHACSPFVVGG--LDKCDYI 331
            .:|.|          ||.|||:|..|::||::.:|:|.::.  .|...|.. ..||  .|:|..:
  Fly   228 GLPHT----------ELWGYNRVGQNSYPNLIPLLSGQSVDEVEAKSGCYG-ASGGTNFDRCHLL 281

  Fly   332 WKQYQQRGYVTAYAEDAVKINTFNYLKKGFKNPPADYYLRPYLSAAESQLDHTTVNGL-VHCLGY 395
            |..:|..||.|.:.||:....||.|::.|||..|.|:|||..::....:..:.....| :.|.| 
  Fly   282 WHDFQAAGYATIFGEDSRVAGTFTYVRPGFKKRPTDFYLRSVINEIHMRSTYFARGPLEIKCSG- 345

  Fly   396 LTAAEHVYDYGL-EFTRRFL--------NETYFGFFW--TNTHSHSDISQTSSMDSYMEEYLRKL 449
                :.||.:.| :|..|.|        :..:|.|||  ...|.:....:.:..:.|  ..:|.|
  Fly   346 ----DRVYHHVLYDFIYRLLPHMQARMYDRGFFAFFWQTMGVHDYFQYGERADWEYY--RIMRAL 404

  Fly   450 VRQGTMENTVVVFFSDHGMRFGPTRATWSGHLEERLPAIFIWLPQHLRRSHPQFVRSLQLNRNRL 514
            .|:..:|.|:|:..||||:|:||...|:.|..|..||.:....|:.||...|....:|:.|.:||
  Fly   405 KRRKILERTLVLIVSDHGLRYGPFVDTFQGMRETSLPIMVAIYPRSLRERFPLAFANLEANAHRL 469

  Fly   515 TTPYDLHLTMKHILAISGRAEMESLGPAPDCPQCQ--SLLTPVSPQRSCSDVGIADHWCTCWEYD 577
            .|.||||.|:|.::.:...::...|..........  ||..|:..:|||....|..|:|.|..|.
  Fly   470 VTTYDLHETLKDVVDLENLSDERILNRTLRLRNNHNVSLFLPIPEERSCFSARIPLHYCQCDGYV 534

  Fly   578 TISSTSKESRMLGKRVVSYLNNYVAEFRNGTFAKLCAPLSLHSIKSAFRAHHNALDPDEVHTYRL 642
            .|....:..:.:.|..|:.:|..:|.:..      |..|.|.:::.|:....:.|:    .|..:
  Fly   535 KIPWNVRSIQRIAKLAVANINRLLAPYPQ------CEQLELLNVEDAYLRKQHKLN----KTIIV 589

  Fly   643 IFVTSPNKGQYEAT-LRHNHTDDSVKVTGSVSRLNVYSGEADCMNDFAAKKYCYC 696
            ..||.|..|.::|| |..|.|    .:.|.::|.:.|..::.|..:...:.||||
  Fly   590 RLVTQPGNGHFDATVLSKNET----SLQGPITRTDQYRHQSFCAREAPIEIYCYC 640

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7120NP_001246667.1 DUF229 130..622 CDD:281053 142/548 (26%)
ALP_like 253..528 CDD:293745 97/301 (32%)
CG14731NP_650130.1 DUF229 77..573 CDD:281053 142/548 (26%)
ALP_like 200..485 CDD:293745 98/318 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49379
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.