DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7120 and CG31933

Sequence 1:NP_001246667.1 Gene:CG7120 FlyBaseID:FBgn0035888 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_722734.1 Gene:CG31933 FlyBaseID:FBgn0051933 Length:673 Species:Drosophila melanogaster

Alignment Length:743 Identity:178/744 (24%)
Similarity:302/744 (41%) Gaps:166/744 (22%)


  Fly    42 RKSVLGLLVSFTFCYFLIGRTGWVNVLDLDVLHSDNYVTVQHQSTVMDVEPEPITETNPSVPKGF 106
            ||.|||::::....|.|:            .|.:..|                  ||...:...|
  Fly     7 RKLVLGVILTTIILYALL------------FLDTQCY------------------ETGGKIHNAF 41

  Fly   107 LVYSNSCRIMEVDPYKNEVMRHFKRIKYKSCQKLTPLTQVKFEAKSQKYLLSIDGAAFGRYPVGK 171
            .|.::.|||:.:|.....:.::                 ..:|.|.:::.|......:.|..|..
  Fly    42 FVNTDGCRIIAMDVMNPTIAKY-----------------TDWEWKDKRFYLKCPHQTWFRTEVAN 89

  Fly   172 ------------------------QLHCCYMSVQRVDEMKVKYTKCQTF----KGSILLPDSAEG 208
                                    |:.|.:..::.....:.|......|    ..::.:|.....
  Fly    90 GDWYLKLTRDIDRILQESDLTHDWQIKCYWFRIKIKGRWRAKIYGPTMFPLEYPYALKVPKGLRH 154

  Fly   209 IIVKC--DSGGRQIYINGHATV-PVKEAVQQRLRMA-----SEADAKGYQRPPSVLMLGIDSISR 265
            :.|||  ....:.::.:.|..: |..|.:.::....     .|..:.|...|.||::||:||:|.
  Fly   155 MRVKCLNTFTNKTLHDDAHFFIQPPPEKLLKKPPATLKYWDGEKHSSGATSPISVMILGLDSVSH 219

  Fly   266 VNLIRAMPKTAQYLYDN-GWFELAGYNKVDDNTFPNIMAVLTGYNLPNA-----MHACSPFVVGG 324
            :||:|.||:|.:|:..| ...|..|:||:..||:||::|:|||.:...:     ...|       
  Fly   220 LNLLRQMPRTVRYMRQNMSQVEFWGFNKIGTNTYPNLIALLTGLSAAESEAYWVRQKC------- 277

  Fly   325 LDKCDYIWKQYQQRGYVTAYAEDAVKINTFNYLKKGFKNPPADYYLRP-----YLSAAESQLDHT 384
            :|....|||::::.||.|::|||....:.|.:.|.|||.|..|..|..     |::...|.:..|
  Fly   278 MDNLPLIWKEFKRAGYNTSFAEDMAIYSMFYFGKPGFKRPTTDNNLHDFMVDLYINRQASSVSDT 342

  Fly   385 TVNGLVHCLGYLTAAEHVY-DYGLEFTRRFLNET----YFGFFWTNTHSHSDISQTSSMDSYMEE 444
                  ||:|     |..: |..||...|.|..|    :|.|:|.....|...:.....|...|.
  Fly   343 ------HCMG-----ERAFMDILLEMNDRLLPHTQRYPFFSFYWWANGFHEFFNSPRLADGRFER 396

  Fly   445 YLRKLVRQGTMENTVVVFFSDHGMRFGPTRATWSGHLEERLPAIFIWLPQHLRRSHPQFVRSLQL 509
            .||.|...|...||::.|.||||:|:|..|:::.|.:|:..|.:.:..|:.:|..:|..::||..
  Fly   397 LLRSLDDAGITNNTIIFFMSDHGLRWGLFRSSFQGMIEDSQPFLSVLYPKWMRLKYPMAIKSLVG 461

  Fly   510 NRNRLTTPYDLHLTMKHIL--------AISGRAEMESLGPAPDCPQCQSLLTPVSPQRSCSDVGI 566
            |.:.|.|.||||.|:||||        :|:.:.|..........|:..||..|:.|.|:|:...|
  Fly   462 NAHSLVTTYDLHETLKHILEPSSLEDTSITQKTEELWKLKGSQTPRAVSLFLPIPPWRNCNTSHI 526

  Fly   567 ADHWCTCWEYDTISSTSKESRMLGKRVVSYLNNYVAEFRNGTFAKLCAPLSLHSIKSAF------ 625
            ...:|.|.:...|..:::........::.|:|..:.|:      .:|.||.|.||:||:      
  Fly   527 PSKFCLCHKQIPIPESNRVVTKSASIIIDYVNQLMVEY------PVCIPLQLDSIESAYFAAPQR 585

  Fly   626 -------RAHHNALDPD-------EVHTYRLIFV---TSPNKGQYEATLRHNHT-----DDSVKV 668
                   :.|.|.. |:       :.:..|.|.|   |.|....:|...|...:     .:.|:|
  Fly   586 DDDFYIEKGHKNVY-PEKGPFWKKQKYEDRDIVVRLKTKPGNAYFEGMTRRQGSKLSLVGEVVRV 649

  Fly   669 TGSVSRLNVYSGEADCMNDFAAKKYCYC 696
            .|..:|.|      ||:::...:.:|:|
  Fly   650 GGEGNRNN------DCIDNPLLEPFCHC 671

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7120NP_001246667.1 DUF229 130..622 CDD:281053 140/552 (25%)
ALP_like 253..528 CDD:293745 98/291 (34%)
CG31933NP_722734.1 DUF229 114..576 CDD:281053 135/486 (28%)
ALP_like 208..483 CDD:293745 99/293 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49388
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.