DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7120 and F32D8.2

Sequence 1:NP_001246667.1 Gene:CG7120 FlyBaseID:FBgn0035888 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_505771.2 Gene:F32D8.2 WormBaseID:WBGene00009327 Length:568 Species:Caenorhabditis elegans

Alignment Length:691 Identity:122/692 (18%)
Similarity:241/692 (35%) Gaps:236/692 (34%)


  Fly    43 KSVL--GLLVSFTFCYFLIGRTGWVNVLDLDVLHSDNYVTVQHQSTVMDVEPE---PITETNPSV 102
            :|:|  .:::.| .|:||:..:..::...:::...|....:::       :||   .:.||..  
 Worm     9 QSILPSSMILMF-LCFFLLIFSVIMSHFSIEIKEFDKDGGIKY-------KPEFVYSLVETRE-- 63

  Fly   103 PKGFLVYSNSCRIMEVDPY---KNEVMRHFKRIKYKSCQKLTPLTQVKFEAK----SQKYLLSID 160
                 :.:|.|::    ||   .||....|.....||.|.:     |:.|.|    ::|..||.|
 Worm    64 -----LLTNVCKL----PYIFFPNEDEDVFGLTPDKSKQHI-----VRGECKINELNEKVDLSSD 114

  Fly   161 GAAFGRYPVGKQLHCCYMSVQRVDEMKVKYTKCQTFKGSILLPDSAEGIIVKC----DSGGRQIY 221
            |               |::::.              |.:..||..     ::|    :||..:..
 Worm   115 G---------------YLTLRS--------------KNTNDLPSD-----IRCTFYKNSGPNEHP 145

  Fly   222 INGHATVPVKEAVQQRLRMASEADAKG---YQRP-------------PSVLMLGIDSISRVNLIR 270
            |.....||||...   ...|...:..|   :.:|             .|:.::.:.:|:....::
 Worm   146 IKVEKNVPVKVPF---YNFAFACERNGIVEFLKPFVNFASIPKKSNGGSIAIIFLPAINHKLFMK 207

  Fly   271 AMPKTAQYLYDNGWFELAGY-NKVDDNTFPNIMAVLTGYNLPNAMHACSPFVVGGLDKCDYIWKQ 334
            .||.:..::.|| .|..|.: :|.:.|:..:::..|                  |:..       
 Worm   208 KMPLSKHFMQDN-QFRFAQFMSKNEPNSMQDLLLQL------------------GISN------- 246

  Fly   335 YQQRGYVTAYAEDAVKINTFNYLKKG-----FKNPPADYYLRPYLSAAESQLDHTTVNGLVHCLG 394
                           |||.|...|:.     |..|....|:   :......|||.         .
 Worm   247 ---------------KINMFRKAKQNNFTTFFSGPQQIRYM---IDVDYDTLDHQ---------N 284

  Fly   395 YLTAAEHVYDYG--LEFTRRFLNETY--FGFFWTNTHSHSDISQTSSMDSYMEEYLRKLVRQ--- 452
            ::|  :.:.|..  |:..::.:|:..  .|.|.|:| :.|.:.....:|.| :||.|:.:.|   
 Worm   285 FIT--QFLIDGNLCLKNGKKLVNDQLEKIGAFLTST-ADSKVFSAMFIDEY-DEYRRQSIDQDLK 345

  Fly   453 ---------GTMENTVVVFFS-DHGMRFGPTRATWSGHLE---ERLPAIFIWLPQHLRRSHPQFV 504
                     ...|||.::..| |...:          .:|   ::.| :|.:.|.:      ||:
 Worm   346 KMLDLLKESNIFENTTLIITSYDLSTK----------DIENENDKYP-MFAFRPSN------QFI 393

  Fly   505 RSLQLNRNRLTTPYDLHLTMKHILAISGRAEM--ESLGPAPDCPQCQSLLTPVSPQRSCSDVGIA 567
            .:   |..:|   |.:::....:|:.:...:|  |.:.|.....:...:..|.|  |:|:..||:
 Worm   394 EN---NNQKL---YFMNMNFNRLLSSTNFNQMLVELINPKEKSSKSVFIAQPTS--RNCTSEGIS 450

  Fly   568 DHWCTCWEYDTISSTSKESRMLGKRVVSYLNNYVAEFRNGTFAKLCAPLSLHSIKSAFRAHHNAL 632
            ::.|.|....|.|...::..          .|::...|    .:....:..|....:|       
 Worm   451 ENICLCMNMSTSSGYPEKGE----------KNFLQTLR----TRFTQEVKTHKCVRSF------- 494

  Fly   633 DPDEVHTYRLIFVTSPNKGQYEATLRHNHTDDSVKVTGSVS 673
               |:..|::.         ||.::..:.....|::||.|:
 Worm   495 ---ELEDYKIF---------YEYSIGTSKEVRGVELTGFVN 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7120NP_001246667.1 DUF229 130..622 CDD:281053 95/544 (17%)
ALP_like 253..528 CDD:293745 52/301 (17%)
F32D8.2NP_505771.2 DUF229 <324..463 CDD:281053 33/165 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49883
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.