DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7120 and F10C2.3

Sequence 1:NP_001246667.1 Gene:CG7120 FlyBaseID:FBgn0035888 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_506015.2 Gene:F10C2.3 WormBaseID:WBGene00008644 Length:604 Species:Caenorhabditis elegans

Alignment Length:615 Identity:159/616 (26%)
Similarity:267/616 (43%) Gaps:67/616 (11%)


  Fly    97 ETNPSVPKGFLVYSNSCRIMEVDPYKNEVMRHF----KRIKYKSCQKLTPLTQVKFEAKSQKYLL 157
            :|..||.:.....|:.|.:..:||:...::.:.    .|....:|.......::.|  ..:..:|
 Worm    34 KTRRSVARQKQNSSSKCVVPTLDPWDQSILEYVLDDGSRPTQLACHDAKVQPELTF--LDENGVL 96

  Fly   158 SIDGAAFGRYPVGKQLHCCYMSVQRV--DEMKVKYTKCQTFKGSILLPDSAEGIIVKCDSG---G 217
            .::..|.....:  ::.|.|.:..::  |:.::.|::..:|..|:.:  .:|.:.|.|...   .
 Worm    97 QLNSTAVSESSL--KVECQYRTYDKMDGDDEQLNYSEWISFNMSVKI--ESEFVEVSCQRAWFPR 157

  Fly   218 RQIYINGH-ATVPVKEAVQQRLRMASEADAKGYQRPPSVLMLGIDSISRVNLIRAMPKTAQYLYD 281
            .::|.|.| ..:|:     .|.:..|:..        ||:::.:||:|..|..|.|.||...::.
 Worm   158 TKVYSNNHNQIIPI-----SRSQPVSDKS--------SVIVIVLDSVSHSNFRRTMNKTLDVMHS 209

  Fly   282 -NGWFELAGYNKVDDNTFPNIMAVLTG--YNLP-NAMHACSPFVVGGLDKCDYIWKQYQQRGYVT 342
             .|.|...|..|:.||:|.|.:....|  :|.. ...|       |..|..|.|||.|::.||.|
 Worm   210 LYGSFIFDGMTKIGDNSFSNAVGFFAGKWWNTEFGDAH-------GYFDDHDLIWKHYRENGYRT 267

  Fly   343 AYAEDAVKINTFNYLKKGFKNPPADYYLRPYLSAAESQLDHTTVNGLVHCLGYLTAAEHVYDYGL 407
            .||||....|.||||.||||..|.|:|.|||.........|.....|  |.|.........:|..
 Worm   268 LYAEDYPGFNLFNYLSKGFKKKPVDHYFRPYWLNVYWTYVHRRSRNL--CYGNHRMHNLQLNYLS 330

  Fly   408 EFTRRFLNETYFGFFWTNTHSHSDISQTSSMDSYMEEYLRKLVRQGTMENTVVVFFSDHGMRFGP 472
            :|..::.::..|...|.....|..::|....|..:..:|:|.|..  :||:.:...||||.||..
 Worm   331 QFVSKYKDQPKFAISWLTELGHDWLNQVRYGDEDLANFLKKHVED--LENSYLFIMSDHGHRFDN 393

  Fly   473 TRATWSGHLEERLPAIFIWLPQHLRRSHPQFVRSLQLNRNRLTTPYDLHLTMKHILAISGRAEME 537
            .|.|..|.||||||...:.||:.||:. .:.|.:::.|..:||:.:|::.|.:|||..|.:    
 Worm   394 IRKTSIGRLEERLPFFSVSLPKKLRKD-SKLVDTVRKNSKKLTSFFDVYATFRHILNNSKQ---- 453

  Fly   538 SLGPAPDCPQCQSLLTPVSPQRSCSDVGIADHWCTC-WEYDTISSTSKESRMLGKRVVSYLNNYV 601
                 ||..:.:||..|:. .|:|....|.:.:|.| .|.....|.:.:.|.:.:.....:|..:
 Worm   454 -----PDVMRGESLFLPIK-DRNCETAHIPEEFCVCDTEVPLNVSANAQIRTMAEDFAKDINQRL 512

  Fly   602 AEFRNGTFAKLCAPLSLHSIKSAFRAHHNALDPDEVHTYRLIFVTSPNKGQYEATLRHNHTDDSV 666
            .....      |..|.|.::.|..:..    |..| ..||.....||:...:||.|.::..:...
 Worm   513 DPHPQ------CVQLYLKNVISVSQVG----DVKE-QRYRFTIEVSPSNAIFEALLLYDPFESQT 566

  Fly   667 KVTGSVSRLNVYSGEADCMNDFAAKKYCYC 696
            .|.|.::|:|.|..::.|:.|...:|.|:|
 Worm   567 TVIGDINRINKYGNQSLCVQDQFLRKLCFC 596

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7120NP_001246667.1 DUF229 130..622 CDD:281053 132/503 (26%)
ALP_like 253..528 CDD:293745 93/279 (33%)
F10C2.3NP_506015.2 DUF229 110..527 CDD:281053 127/460 (28%)
ALP_like 182..451 CDD:293745 94/281 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H44601
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T98015
orthoMCL 1 0.900 OOG5_130693
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.960

Return to query results.
Submit another query.