DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7120 and Y38A10A.2

Sequence 1:NP_001246667.1 Gene:CG7120 FlyBaseID:FBgn0035888 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_504570.2 Gene:Y38A10A.2 WormBaseID:WBGene00021389 Length:599 Species:Caenorhabditis elegans

Alignment Length:688 Identity:138/689 (20%)
Similarity:248/689 (36%) Gaps:203/689 (29%)


  Fly    44 SVLGLLVSFTFCYFLIGRTGWVNVLDLDVLHSDNYVTVQHQSTVMDVEPEPITETNPSVPKGFLV 108
            ||||..|     |:......|..|..||.:...:.:.             |....:|      ::
 Worm    10 SVLGASV-----YYWQHNKEWSYVQTLDDIDRGDVIL-------------PNYNAHP------IL 50

  Fly   109 YSNSCRIMEVDPYKNEVMRHFKRIKYKSCQKLTPLTQVKF-EAKSQKYL-----LSIDGAAFGRY 167
            | |.|....:|||:.:::::.|:...:...:.:|..:|:: ::|.|..|     :|...:....:
 Worm    51 Y-NECTWPILDPYEPDILKYIKKRNRRLACRSSPDVEVEWLDSKIQITLKSANVMSCVASDLSGF 114

  Fly   168 PVGKQLHCCYMSVQRVD-EMKVKYTKCQTFKGSILLPDSAEGIIVKCDSGGRQIYINGHATVPVK 231
            ...:.:..........| .:::.||                ...|:|:..|::||..........
 Worm   115 SANEDVFVSPAIKLEADFPLEIPYT----------------NFAVECEQNGKRIYRKSFYNYKKD 163

  Fly   232 EAVQQRLRMASEADAKGYQRPPSVLMLGIDSISRVNLIRAMPKTAQYLYDNGWFELAGYNKVDDN 296
            :|.:....|.|...:      ||:.:|.:.|:|...|.|..|||.:.....|:::.|.:||:.| 
 Worm   164 QAEKPVEAMESTPTS------PSIAVLYLRSMSHSQLQREFPKTVKASRKFGFYDFAMFNKISD- 221

  Fly   297 TFPNIMAVLTGYNLPNAMHACSPFVVGGLDKCDYIWKQYQQRGYVTAYAEDAVKINTFNYLK--- 358
               ||..::.|                                  |.:.:| |:.....|:|   
 Worm   222 ---NITDIVNG----------------------------------TFWHKD-VRHTVGEYMKNER 248

  Fly   359 --KGFKNP-----PADYYLRPYLSAAES---------------QLDHTTVNGLVHCLGYLTAAEH 401
              |.|.|.     |:||.:..:..:.:|               |....:::...||  ||:   |
 Worm   249 FCKVFSNTNLSGVPSDYDISNWAHSLKSDSCSDDDSVSERLIEQWAQFSIHNTDHC--YLS---H 308

  Fly   402 VYDYGLEFTRRFLNETYFGFFWTNTHSHSDISQTSSMDSYMEEYLRKLVRQGTMENTVVVFFSDH 466
            :          |:|.|    .|           :.|:|..:...:.:.......:||:||..|..
 Worm   309 I----------FVNNT----IW-----------SKSLDDTLSSVMNQFQLNEVFKNTLVVVVSAE 348

  Fly   467 GMRFGPTRATWSGHLEERLPAIFIWLPQHLRRSHPQFVRSLQLNRNRLTTPYDLHLTMKHIL-AI 530
            |:..|....:::|.:|||.|.:...:|..:::.:...|..|:.|:|||.|    ||.:..:| :.
 Worm   349 GIPVGTFGNSYTGKVEERNPILLAHIPDKVKKLYSDHVFHLESNQNRLIT----HLEVFDLLTSF 409

  Fly   531 SGRAEMESLGPAPD--CPQCQSLLTPVSP-------QRSCSDVGIADHWCTCW--------EYDT 578
            |..::.:.:.|..|  ....:..:..:||       .|:|..|.|||.:|.|.        ||:.
 Worm   410 SRLSKNQVIVPVLDDFMDWKRKHVRGISPWQTLIPRNRTCYHVPIADEFCLCMDRKMDIEREYNQ 474

  Fly   579 ISSTSKESRMLGKRVVSYLNNYVA-------EFRNGTFAKLCAPLSLHSIKSAFRAHHNALDPDE 636
            ..:.::  |:..|.....|:||..       |.||.|              |.:..:...|:..|
 Worm   475 TFAIAQ--RLYDKMESDILSNYSCMHETTWIEERNYT--------------SVYNLNEKVLNGTE 523

  Fly   637 VHTYRLIFVTS--PNK----GQYEATL----RHNHTDD 664
            .:...|||...  |.|    |.:...:    :||..||
 Worm   524 EYIEFLIFGVRAFPKKINRLGNFFVNVLGMFKHNFNDD 561

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7120NP_001246667.1 DUF229 130..622 CDD:281053 107/549 (19%)
ALP_like 253..528 CDD:293745 64/300 (21%)
Y38A10A.2NP_504570.2 DUF229 72..465 CDD:281053 95/488 (19%)
ALP_like 179..405 CDD:304875 64/299 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.