DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Try10

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:277 Identity:86/277 - (31%)
Similarity:129/277 - (46%) Gaps:65/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSII 70
            |:|.||:..|:.|          .|....|   :|..||..:|...||.|.|. ||..:||||:|
  Rat     3 AVLILALVGAAVA----------FPAADDD---KIVGGYTCQENSVPYQVSLN-SGYHFCGGSLI 53

  Fly    71 AHDWVLTAEHC--------IGDADSVTVYFGATWRTNAQFTH---WVGNGNFIKHS-SADIALIR 123
            ...||::|.||        :|: .::.|..|     |.||.:   .:.:.|||:.: :.||.||:
  Rat    54 NEQWVVSAAHCYKSRIQVRLGE-HNINVLEG-----NEQFVNAAKIIKHPNFIRKTLNNDIMLIK 112

  Fly   124 IPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVAC----------GWGGTYD-GSPLPDYLQCVDL 176
            :.. |.....|..|.|||              :|          |||.|.. |...||.|||:|.
  Rat   113 LSSPVKLNSRVATVALPS--------------SCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDA 163

  Fly   177 QIIHNSEC-SGYYGSVGDNILCVR-TPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQ-SG 238
            .::..::| :.|.|.:.||::|.. ...||.:|.||||||:|.:.  :|.|:.::|  .||. ..
  Rat   164 PLLPQADCEASYPGKITDNMVCAGFLEGGKDSCQGDSGGPVVCNG--ELQGIVSWG--YGCALPD 224

  Fly   239 APAGFQRVTYHLDWIRD 255
            .|..:.:|..::|||:|
  Rat   225 NPGVYTKVCNYVDWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 75/240 (31%)
Tryp_SPc 40..256 CDD:238113 78/243 (32%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 75/240 (31%)
Tryp_SPc 24..242 CDD:238113 78/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.