DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and LOC101731336

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_004916443.1 Gene:LOC101731336 / 101731336 -ID:- Length:300 Species:Xenopus tropicalis


Alignment Length:271 Identity:48/271 - (17%)
Similarity:78/271 - (28%) Gaps:98/271 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIA 71
            :.:|.....:||....|..:|||  ..|:.|.                         :|..|:|.
 Frog    17 VFSLTCYHYNGAADHALGQQKLT--ECKNSQR-------------------------YCSSSLIT 54

  Fly    72 HDWVL----TAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHSSADIALIRIPHVDF--- 129
            :...|    ..:.|..|.:      ||..:|                ::|::..:...|:..   
 Frog    55 YSGQLYLKVLVKGCTDDEE------GACNKT----------------ATANMKDLESQHIKLCCE 97

  Fly   130 WHMVNKVELPSYNDRYNDYNEWWA---------VACGWGGTYDGSPLP------DYLQCVDLQII 179
            ..:.||...|   |...|..:|..         ..||.||      ||      ....|:.:.|.
 Frog    98 TDLCNKELEP---DLGPDAQKWGTECLACNGPPTECGGGG------LPGLRCKTSQSSCIQVSIA 153

  Fly   180 HNSECSGYYGSVGDNILCVRTPDGKSTCGG----DSGGPLVTH-------DGTKLVGVTNFGSVA 233
            ...|...|.       :.:::....|.|.|    .:|...||:       .||.........:..
 Frog   154 TAVEKESYK-------VMIKSCSNSSVCPGMAAFSNGQNPVTYVSHHECCTGTHCNNGHFIDTEP 211

  Fly   234 GCQSGAPAGFQ 244
            |.::|....||
 Frog   212 GSENGLECYFQ 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 39/239 (16%)
Tryp_SPc 40..256 CDD:238113 39/238 (16%)
LOC101731336XP_004916443.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.