DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Culd and Neto2

Sequence 1:NP_729364.1 Gene:Culd FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster
Sequence 2:XP_011246830.1 Gene:Neto2 MGIID:1921763 Length:560 Species:Mus musculus

Alignment Length:494 Identity:107/495 (22%)
Similarity:181/495 (37%) Gaps:130/495 (26%)


  Fly   158 QLKFFYRASNAHVFSLQYF------SERNVRIVSGSPKQSIVGNGSTKSQPQVISTPYFPMAYPR 216
            |...:.|.||...|:...:      ::..:.|:..:|:|.|                  .:.:..
Mouse    79 QCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRI------------------ELTFDE 125

  Fly   217 DYGIEHILTCEADNCQVRLDFTDFQLGLTSTLEIFDSNGQMLDSYTGEHFRPPITVSSGKSLLLQ 281
            .|.||....|..|:.::|    |...|.:          .::|.|.|.. .|.:..|:|:.:.::
Mouse   126 RYYIEPSFECRFDHLEIR----DGPFGFS----------PLIDRYCGMK-SPALIRSTGRFMWIK 175

  Fly   282 FRGN-SATGVGFRAEVSFVSSKQLK--DERLVPYTDCGGMVTGPGGAI--TMMNMIENATDVRLF 341
            |..: ...|:||||:.||:......  ...|.|..||...::|..|.:  :.:...|.....:..
Mouse   176 FSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQAV 240

  Fly   342 DCIWIIKPGNNYMMMKTHISLRVDDFY----GMAARSELTIRQGTTSDAVEIENVMWPNNGLSKE 402
            ||||.||     ...|..|.||..|:.    ....|:.:.:..|:::    |||:        |.
Mouse   241 DCIWTIK-----ATPKAKIYLRFLDYQMEHSNECKRNFVAVYDGSSA----IENL--------KA 288

  Fly   403 SHVAPILNGYYIRLR-GVFGM-------SSKLAIVYSVFNYLNCYIGSEFLCGNNHCISIRLHCD 459
            ...:.:.|...::.. ||..|       .|:..::::.|....| ..|.|.|.:|.||:..|.|:
Mouse   289 KFCSTVANDVMLKTGVGVIRMWADEGSRLSRFRMLFTSFVEPPC-TSSTFFCHSNMCINNSLVCN 352

  Fly   460 GFDHCGDGSDEPDSCEEDWAHLHHDRRWYSHKPNYYFPKIDQYPDLKTATGIF--IISTLG-IFG 521
            |..:|....|| :.|:|                             |...|:|  |..|.| |.|
Mouse   353 GVQNCAYPWDE-NHCKE-----------------------------KKKAGLFEQITKTHGTIIG 387

  Fly   522 VLSGWMVILYRMG--VRARHQRELQSHLQT------ISELLDRQDEDRTPDEPPSYEAPPDYEEV 578
            :.||.:::|..:.  |:.:..|:.....:|      ..|:.|          ||.||.....|:.
Mouse   388 ITSGIVLVLLIISILVQVKQPRKKVMACKTAFNKTGFQEVFD----------PPHYELFSLREKE 442

  Fly   579 IK---VGMQQELREPRRQRRARRAPP--RDRSCSRAASN 612
            |.   ..:.:||...::.||:..|..  .|..|...||:
Mouse   443 ISADLADLSEELDNYQKLRRSSTASRCIHDHHCGSQASS 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CuldNP_729364.1 CUB 200..298 CDD:238001 21/99 (21%)
LDLa 442..472 CDD:238060 12/30 (40%)
Neto2XP_011246830.1 CUB 80..193 CDD:238001 29/146 (20%)
CUB <240..326 CDD:238001 22/103 (21%)
LDLa 332..366 CDD:238060 13/36 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.