DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Culd and sorl1

Sequence 1:NP_729364.1 Gene:Culd FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster
Sequence 2:XP_005157607.1 Gene:sorl1 ZFINID:ZDB-GENE-050208-22 Length:2213 Species:Danio rerio

Alignment Length:659 Identity:131/660 (20%)
Similarity:196/660 (30%) Gaps:283/660 (43%)


  Fly   437 NCYIGSEFLCGN-------NHCISIRLHCDGFDHCGDGSDEPDSCEEDWAHLHHDRRWYSH---- 490
            ||......||.|       ..|:.....||||..|.|.|||.:..:|...:...:.:|.::    
Zfish  1508 NCPTHGPLLCANGTRCADGEACLLNSERCDGFIDCSDRSDEHNCTDEQQVYKVQNLQWTANFSGA 1572

  Fly   491 -KPNYYFPKIDQYPDLKTATGIFII--STLGIFGVLSGW--------------MVILYRMGVRAR 538
             |..:..||     ::.|::..|:|  ..:|:    ..|              .|::.......:
Zfish  1573 VKLTWTRPK-----NMPTSSCSFVIYFRPVGV----QQWTSIDTNSNKGSAVLTVLMPDTTYNVK 1628

  Fly   539 HQRELQSHLQTISELLDRQDEDRTPDEPPSYE---------------APPD------------YE 576
            .|.:..|.....:|.|..:..:..||.|.|.:               :|||            |.
Zfish  1629 VQTQCLSKQHRTNEYLTLRTPEGLPDPPQSLQLSCDKADDGTVLCSWSPPDKTHGHIREYIVEYS 1693

  Fly   577 E--------VIKVGMQQELR--EPRRQRRARRAPPRDRSCSRAASNCT-VQSVLPLHRSCTLERD 630
            |        :.......|::  :|....|.|.|    ...||...|.| ::|::|          
Zfish  1694 EKDSAEWFSLSSTSTNAEVKNLQPSSLYRFRVA----AVTSRGVGNWTEIKSIIP---------- 1744

  Fly   631 QEQPSTSAAAMTHAVAATDTTEDA-------------------------EHVQTMAQRMLLATAI 670
              |.:.|...:|    .|..|||:                         |||             
Zfish  1745 --QKALSPPKVT----ITSITEDSMSLSISNDYKVKVKLYIVVISWVFDEHV------------- 1790

  Fly   671 CGTAGTSLPAAKESGQRVQSVGISTSPSSLSAGGELPTAGGSATTPGSTADECTQGGDSLSISLT 735
                       |||..  .:|..:...|:|:||.|...|..:.          |..|||   ...
Zfish  1791 -----------KESWN--YTVPETLKVSNLTAGTEYEVAVWAH----------TDDGDS---PTA 1829

  Fly   736 LGLPSTTAESPVTTDQNQLQKQSPEQTISNCTEHTFLKRSWLVVQQVPPGRGYRV---------- 790
            |....|....||   |..|:.::..||..:|        :|    ..||...|.|          
Zfish  1830 LSRQQTKGSRPV---QPSLKARALNQTAVDC--------NW----TGPPAEMYAVFYATSFLDLF 1879

  Fly   791 RRLRHTFSSPEAFT----SDELHL-------PY-------------PDFLSYGTNL--------- 822
            ||.....|:..:.|    |||.:|       ||             ||......||         
Zfish  1880 RRPHRVNSTSSSLTVIVDSDEQYLFLVRVVSPYMGPPSNYAVVKMIPDERLPPRNLHKVRVDKTQ 1944

  Fly   823 -------PHERSSSNFGSELSRDPSSYSVGKR--ARLTPEDTSGSETITQEMEQSNQTLQSHVIV 878
                   |::..||         |.:|:|..|  .|.|..|   .:.|||     |.|:: :.:.
Zfish  1945 ATLKWQPPYDSPSS---------PLTYAVHVRDTVRKTESD---YKVITQ-----NNTVE-YTLK 1991

  Fly   879 ESHP-----------NHSESES-----------------EAEQQVSCF-GAVAQRPKRRHRGHVR 914
            ...|           |.|:..|                 |.|..|..| .::|          |:
Zfish  1992 GLEPAGRYSITIRLLNMSKEASYTLSTVPLPAPEALKILEEEDHVFLFWKSLA----------VK 2046

  Fly   915 SRSFSNARG 923
            .|:|:.:||
Zfish  2047 DRTFNESRG 2055

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CuldNP_729364.1 CUB 200..298 CDD:238001
LDLa 442..472 CDD:238060 13/37 (35%)
sorl1XP_005157607.1 VPS10 130..754 CDD:214740
Sortilin_C 589..754 CDD:292523
LY 781..822 CDD:214531
LY 825..864 CDD:214531
LY 868..912 CDD:214531
LY 916..954 CDD:214531
LDLa 1079..1113 CDD:238060
LDLa 1118..1154 CDD:238060
LDLa 1159..1193 CDD:238060
LDLa 1242..1273 CDD:238060
LDLa 1282..1310 CDD:197566
LDLa 1327..1361 CDD:238060
LDLa 1376..1405 CDD:238060
LDLa 1421..1455 CDD:238060
LDLa 1474..1509 CDD:238060 1/1 (100%)
LDLa 1522..1551 CDD:238060 10/29 (34%)
FN3 1559..>1630 CDD:238020 10/80 (13%)
FN3 1653..1743 CDD:238020 19/94 (20%)
FN3 1750..1827 CDD:238020 22/120 (18%)
FN3 1931..2007 CDD:238020 18/94 (19%)
FN3 2022..2097 CDD:214495 10/45 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.