DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Culd and LpR1

Sequence 1:NP_729364.1 Gene:Culd FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_001097934.2 Gene:LpR1 FlyBaseID:FBgn0066101 Length:1076 Species:Drosophila melanogaster

Alignment Length:740 Identity:127/741 (17%)
Similarity:196/741 (26%) Gaps:308/741 (42%)


  Fly    52 SPAGEVHARNVTTTAYRSSPLVFKN--DAVAGDVWYQCSLELVTCAECVIRVAFTYANFSKSCGN 114
            |.|.|.....:.:|....||:.|.|  :....:..::|:     ||...:.:......|.|.|..
  Fly     9 STASETTKTAIKSTTSSKSPVTFGNLGEKRRAEQLFRCA-----CANFNLLLLTLMLGFGKCCTA 68

  Fly   115 T----GGKSSMCPCEHIQFSEPPYDSTISGQEFCGDGKVFRSKTRTLQLKFFYRASNAHVFSLQY 175
            |    ...|:..|...:....|.............|||.|.:    :..||.             
  Fly    69 TPTPLNTPSTNTPTSAVSPHNPQTLDESGSLSKVIDGKAFIN----MGFKFL------------- 116

  Fly   176 FSERNVRIVSGSPKQSIVGNGST------KSQPQVISTPYFPMAYPRDYGIEHILTCEAD-NCQV 233
                ||....|:|    :|.|.:      :.|.|..|....|:.:          .|:.| :|: 
  Fly   117 ----NVSGKIGTP----LGIGQSLEAKCDEKQFQCHSGDCIPIRF----------VCDGDADCK- 162

  Fly   234 RLDFTDFQLGLTSTLEIFDSNGQMLDSYTGEHFRPPITVSSGKSLLLQFR-GNSATGVGFRAEVS 297
              |.:|.|:.....:|                    .|.||.     ||| ||.          :
  Fly   163 --DHSDEQIKECKFIE--------------------ATCSSD-----QFRCGNG----------N 190

  Fly   298 FVSSKQLKDERLVPYTDCGGMVTGPGGAITMMNMIENATDVRLFDC---------IWIIKPGNNY 353
            .:.:|...|:.    :||.      .|:.....:..||.....|.|         .|:. .|:|.
  Fly   191 CIPNKWRCDQE----SDCA------DGSDEANELCMNACPNNEFKCQTVDQCIPRSWLC-DGSND 244

  Fly   354 MMMKTHISLRVDDFYGMAARSELTIRQGTTSDAVEIENVMWPNNGLSKESHVAPILNGYYIRLRG 418
            ...|:               .|...|..|.|          |:....|..      .|..:.|..
  Fly   245 CRDKS---------------DEAHCRARTCS----------PDEYACKSG------EGQCVPLAW 278

  Fly   419 VFGMSSKLAIVYSVFNYLNCYIGS------------EFLCGNNHCISIRLHCDGFDHCGDGSDEP 471
            :...|.            :|..||            ||.|||..||..|..||..|.|||||||.
  Fly   279 MCDQSK------------DCSDGSDEHNCNQTCRADEFTCGNGRCIQKRWKCDHDDDCGDGSDEK 331

  Fly   472 D----SCEEDWAHLHHD-----RRWYSHKPNYYFPKIDQYPDLKTATGIFIISTLGIFGVLSGWM 527
            :    .|:....|...:     :||.          .|..||....:                  
  Fly   332 ECPVVPCDSVAEHTCTNGACIAKRWV----------CDGDPDCSDGS------------------ 368

  Fly   528 VILYRMGVRARHQRELQSHLQTISELLDRQ----------------DEDRTPDEPPSYEAPPDYE 576
                       .:|...:..:|.:..|..:                |.||        :.|...:
  Fly   369 -----------DERSCANVTKTTTPCLSHEYQCKDRITCLHHSWLCDGDR--------DCPDGDD 414

  Fly   577 EVIKVGMQQELREPRRQRRARRAPPRDRSCSRAASNCTVQSVLPLHRSCTLERDQEQPSTSAAAM 641
            |                   ..|..::.:|......|..:|.:|.|.:|..::|           
  Fly   415 E-------------------HTANCKNVTCRADQFQCGDRSCIPGHLTCNGDKD----------- 449

  Fly   642 THAVAATDTTEDAEHVQTMAQRMLLATAICGTAGTSLPAAKESGQRVQSVGISTSPSSLSAGGEL 706
                 ..|.:::.:               ||.                |:.:..:....:|..|.
  Fly   450 -----CADGSDERD---------------CGL----------------SLSLGINQGGCNATSEF 478

  Fly   707 PTAGGSATTPGSTAD---ECTQGGD 728
            ...||.........|   :|..|.|
  Fly   479 DCGGGQCVPLSKVCDKRKDCPDGED 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CuldNP_729364.1 CUB 200..298 CDD:238001 19/100 (19%)
LDLa 442..472 CDD:238060 19/42 (45%)
LpR1NP_001097934.2 LDLa 135..167 CDD:197566 9/45 (20%)
LDLa 178..210 CDD:197566 13/57 (23%)
LDLa 219..254 CDD:238060 7/51 (14%)
LDLa 259..295 CDD:238060 9/64 (14%)
LDLa 343..373 CDD:238060 7/69 (10%)
LDLa 383..415 CDD:197566 5/40 (13%)
Ldl_recept_a 423..459 CDD:278486 8/67 (12%)
LDLa 476..504 CDD:197566 7/29 (24%)
FXa_inhibition 514..549 CDD:291342
EGF_CA 551..581 CDD:214542
LY 662..702 CDD:214531
LY 704..747 CDD:214531
LY 749..790 CDD:214531
FXa_inhibition 864..905 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24270
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.