DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pex2 and TED3

Sequence 1:NP_648210.1 Gene:Pex2 FlyBaseID:FBgn0035876 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_565222.1 Gene:TED3 AraportID:AT1G79810 Length:333 Species:Arabidopsis thaliana

Alignment Length:311 Identity:80/312 (26%)
Similarity:138/312 (44%) Gaps:53/312 (17%)


  Fly     7 VPRVNQIDAIYLNKDIARLIRDNLLENLQAISPVLFIKIQPELDLIIQSAIWFGSVGKRCSTFGQ 71
            :.||||.||..|:.:::.::::.|::....:.|.:..:.:||||..::..||..|:.....|.|.
plant    37 ISRVNQFDAARLDVEMSAMLKEQLVKVFTLMKPGMLFQYEPELDAFLEFLIWRFSIWVDKPTPGN 101

  Fly    72 QLLVLAYDAEK------------------LTVSRLVLHFILTVLPGYV----------KSW---E 105
            .|:.|.|..|:                  ||..:.:.:.:.:|...|:          :.|   |
plant   102 ALMNLRYRDERGVVAQHLGKVRTGLEGPGLTSPQKIWYCVASVGGQYLFSRLQSFSAFRRWGDSE 166

  Fly   106 ERRLTRRVEWFSEAIMWVENSALILNILNYFRFLKTGRKPTLVDYLLGLDYISLRNNQRRDIGYK 170
            :|.|.||:....:.|..:..:|..||:|:   ||.|||...|::..|....:....:..|.:.::
plant   167 QRPLARRLWTLVQRIEGIYKAASFLNLLS---FLYTGRYRNLIEKALKARLVYRSPHMNRSVSFE 228

  Fly   171 YLTRELLWGGFMEILGLVLPIINFRKLQRVLKSWT--FSGRRLEDRDGPAFLAPQMTLSTTCTFC 233
            |:.|:|:|..|.|:|.|:||::|...::.:|..:.  .|....||             :.||..|
plant   229 YMNRQLVWNEFSEMLLLLLPLLNSSAVKNILSPFAKDKSSSTKED-------------TVTCPIC 280

  Fly   234 GERPTLPH-HMGCGHIYCYYCLNANVLTDASFCCPNCGS---ACPESGIQS 280
            ...|.:|. .:.|.|.|||||:.....:.|||.|..|..   |....|:.|
plant   281 QVDPAIPFIALPCQHRYCYYCIRTRCASAASFRCLRCNEPVVAIQREGVSS 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pex2NP_648210.1 Pex2_Pex12 22..207 CDD:282595 50/218 (23%)
RING 230..269 CDD:214546 15/40 (38%)
TED3NP_565222.1 Pex2_Pex12 49..242 CDD:282595 44/196 (22%)
RING 276..321 CDD:238093 17/45 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H269
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1494604at2759
OrthoInspector 1 1.000 T124231
orthoMCL 1 0.900 OOG5_129729
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.