DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex2 and TED3

DIOPT Version :9

Sequence 1:NP_648210.1 Gene:Pex2 / 38941 FlyBaseID:FBgn0035876 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_565222.1 Gene:TED3 / 844320 AraportID:AT1G79810 Length:333 Species:Arabidopsis thaliana


Alignment Length:311 Identity:80/311 - (25%)
Similarity:138/311 - (44%) Gaps:53/311 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VPRVNQIDAIYLNKDIARLIRDNLLENLQAISPVLFIKIQPELDLIIQSAIWFGSVGKRCSTFGQ 71
            :.||||.||..|:.:::.::::.|::....:.|.:..:.:||||..::..||..|:.....|.|.
plant    37 ISRVNQFDAARLDVEMSAMLKEQLVKVFTLMKPGMLFQYEPELDAFLEFLIWRFSIWVDKPTPGN 101

  Fly    72 QLLVLAYDAEK------------------LTVSRLVLHFILTVLPGYV----------KSW---E 105
            .|:.|.|..|:                  ||..:.:.:.:.:|...|:          :.|   |
plant   102 ALMNLRYRDERGVVAQHLGKVRTGLEGPGLTSPQKIWYCVASVGGQYLFSRLQSFSAFRRWGDSE 166

  Fly   106 ERRLTRRVEWFSEAIMWVENSALILNILNYFRFLKTGRKPTLVDYLLGLDYISLRNNQRRDIGYK 170
            :|.|.||:....:.|..:..:|..||:|:   ||.|||...|::..|....:....:..|.:.::
plant   167 QRPLARRLWTLVQRIEGIYKAASFLNLLS---FLYTGRYRNLIEKALKARLVYRSPHMNRSVSFE 228

  Fly   171 YLTRELLWGGFMEILGLVLPIINFRKLQRVLKSWT--FSGRRLEDRDGPAFLAPQMTLSTTCTFC 233
            |:.|:|:|..|.|:|.|:||::|...::.:|..:.  .|....||             :.||..|
plant   229 YMNRQLVWNEFSEMLLLLLPLLNSSAVKNILSPFAKDKSSSTKED-------------TVTCPIC 280

  Fly   234 GERPTLPH-HMGCGHIYCYYCLNANVLTDASFCCPNCGS---ACPESGIQS 280
            ...|.:|. .:.|.|.|||||:.....:.|||.|..|..   |....|:.|
plant   281 QVDPAIPFIALPCQHRYCYYCIRTRCASAASFRCLRCNEPVVAIQREGVSS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex2NP_648210.1 Pex2_Pex12 22..207 CDD:282595 50/217 (23%)
RING 230..269 CDD:214546 15/39 (38%)
TED3NP_565222.1 Pex2_Pex12 49..242 CDD:398431 43/195 (22%)
RING-HC_PEX2 276..318 CDD:319440 16/41 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3639
eggNOG 1 0.900 - - E1_KOG2879
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H269
Inparanoid 1 1.050 106 1.000 Inparanoid score I2113
OMA 1 1.010 - - QHG53949
OrthoDB 1 1.010 - - D1494604at2759
OrthoFinder 1 1.000 - - FOG0005881
OrthoInspector 1 1.000 - - oto3153
orthoMCL 1 0.900 - - OOG6_103635
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5660
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.