DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pex2 and pex2

Sequence 1:NP_648210.1 Gene:Pex2 FlyBaseID:FBgn0035876 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_021325996.1 Gene:pex2 ZFINID:ZDB-GENE-070530-2 Length:312 Species:Danio rerio

Alignment Length:304 Identity:96/305 (31%)
Similarity:143/305 (47%) Gaps:61/305 (20%)


  Fly     7 VPRVNQIDAIYLNKDIARLIRDNLLENLQAISPVLFIKIQPELDLIIQSAIWFGSVGKRCSTFGQ 71
            |.|::|:||..|:..:.:|:.....:..|...|.:...::|||..::|..:|..::....:|.||
Zfish    21 VLRISQLDAFELDGALEQLVWSQFTQCFQHFKPGILTPVEPELKALLQLLLWRFTIYSNSATVGQ 85

  Fly    72 QLLVLAYDAEKLTVSRLVLHFILTVLPGY--------VKSWEERRLTRRVEWFSEAIMWVENSAL 128
            .||.:.|..              .::||.        .|.| ...||...:||.|     .:.:|
Zfish    86 SLLNIRYKN--------------ALIPGQKYRPMSRPQKFW-FALLTVGEKWFRE-----RSHSL 130

  Fly   129 ILN-------------------------ILNYFRFLKTGRKPTLVDYLLGLDYISLRNNQRRDIG 168
            .||                         ::|:..||:.|..|||.:.|||:..:..|....|||.
Zfish   131 FLNHPAESNARKARKVLSILLGLTKAASLVNFLLFLQRGTFPTLTERLLGVQPVFSRPQGPRDIN 195

  Fly   169 YKYLTRELLWGGFMEILGLVLPIINFRKLQRVLKSWTFSGRRLEDRDGPAFLAPQMTLSTTCTFC 233
            ::||.|||||.||.|.|..:||:||..||:..: |..||  .|.|..|..  :.:.|..|.|..|
Zfish   196 FQYLNRELLWHGFAEFLIFLLPLINVWKLKAGV-SALFS--PLSDLTGTQ--SSEETHLTECAIC 255

  Fly   234 GERPTLPHHMGCGHIYCYYCLNANVLTDASFCCPNCGSACPESG 277
            ||.||:||.:||.|::||||:.:||:.|..|.||.||:   |:|
Zfish   256 GEWPTMPHSIGCKHVFCYYCVKSNVIADIYFTCPKCGA---ETG 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pex2NP_648210.1 Pex2_Pex12 22..207 CDD:282595 59/218 (27%)
RING 230..269 CDD:214546 21/39 (54%)
pex2XP_021325996.1 Pex2_Pex12 33..225 CDD:309754 57/212 (27%)
RING-HC_PEX2 251..292 CDD:319440 22/41 (54%)
RING-HC finger (C3HC4-type) 252..291 CDD:319440 21/39 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187047314
eggNOG 1 0.900 E1_KOG2879
Hieranoid 1 1.000
Homologene 1 1.000 H269
Inparanoid 1 1.050 143 1.000 Inparanoid score I4369
OMA 1 1.010
OrthoDB 1 1.010 D1494604at2759
OrthoFinder 1 1.000 FOG0004818
OrthoInspector 1 1.000 T1054052
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5623
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.