DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr66a and Gr22d

Sequence 1:NP_523971.3 Gene:Gr66a FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001259882.1 Gene:Gr22d FlyBaseID:FBgn0045498 Length:387 Species:Drosophila melanogaster

Alignment Length:521 Identity:92/522 (18%)
Similarity:165/522 (32%) Gaps:197/522 (38%)


  Fly    11 LLQQF-----QQLFFISKIAGILPQDLEKFRSRNLLEKSRNGMIYMLSTLILYVVLYN----ILI 66
            |.|:|     :.:.:.|.:.||.|...|..:.|  |.:|        ..|||:.|:.:    ||:
  Fly     8 LRQKFVYVILKSILYSSWLLGIFPFKYEPKKRR--LRRS--------MWLILFGVVISSSLLILM 62

  Fly    67 YSFGEEDRS----LKASQ-STLTFVIGLFLTYIGLIMMVSDQLTALRNQGRIGELYERIRLVDER 126
            .....|||.    |...| :.|.:.|...:..:|::.:.:..|..|.....:.|:|..:.|::.:
  Fly    63 VKQSAEDREHGIMLDVFQRNALLYQISSLMGVVGVVSICTVHLRTLWRSKHLEEIYNGLMLLEAK 127

  Fly   127 LYKEGCV----MDNSTIGRRIRIMLIM------------TVIFELSILVSTYVKLVDYSQWMSLL 175
            .:....|    .|...|.:.:.|::.:            :.:..|::||.:.|||          
  Fly   128 YFCSNAVECPAFDGYVIQKGVVIVVGLLAPWMVHFGMPDSKLPVLNVLVVSMVKL---------- 182

  Fly   176 WIVSAIPTFINTLDKIWFAVSLYALKERFE-AINATLEELVDTHEKHKLWLRGNQEVPPPLDSSQ 239
                  .|.:..|......|.:|    ||. .||..|..||.:       ||||.:         
  Fly   183 ------GTLLLALHYHLGVVIIY----RFVWLINRELLSLVCS-------LRGNHK--------- 221

  Fly   240 PPQYDSNLEYLYKELGGMDIGSIGKSSVSGSGKNKVAPVAHSMNSFGEAIDAASRKPPPPPLATN 304
                                   |.||                                      
  Fly   222 -----------------------GSSS-------------------------------------- 225

  Fly   305 MVHESELGNAAKVEEKLNNLCQVHDEICEIGKALNELWSYPILSLMAYGFLIFTAQLYFLYCATQ 369
                           ::..|.::::::..:...|.:.:....:.:||    ||.| ...:.|.  
  Fly   226 ---------------RVRFLLKLYNKLVNLYSKLADCYDCQTVLMMA----IFLA-ANIIVCF-- 268

  Fly   370 YQSIPSLFRSAKNPFITVIVLSYTSGKCVYLIYLSWKTSQASKRTG------------------- 415
            |..:..:..|..:.|:.:|:............:||.|.....::||                   
  Fly   269 YMIVYRISLSKMSFFVMLIMFPLAIANNFMDFWLSMKVCDLLQKTGRQTSMILKLFNDIENMDKD 333

  Fly   416 --ISLHKCGVVADDNLLYEIVNHLSLKLLNHSVDFSACGFFTLDMETLYGVSGGITSYLIILIQF 478
              ||:       .|..||  .:|...|.|:       ||.|.::.|..:.:......||:.|:||
  Fly   334 LEISI-------SDFALY--CSHRRFKFLH-------CGLFHVNREMGFKMFVASVLYLLYLVQF 382

  Fly   479 N 479
            :
  Fly   383 D 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 88/504 (17%)
Gr22dNP_001259882.1 7tm_7 17..386 CDD:285581 89/513 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.