DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr66a and LOC1279272

DIOPT Version :10

Sequence 1:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_318967.4 Gene:LOC1279272 / 1279272 VectorBaseID:AGAMI1_005318 Length:93 Species:Anopheles gambiae


Alignment Length:74 Identity:25/74 - (33%)
Similarity:39/74 - (52%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 NLLYEIVNHLSLKLLNHSVDFSACGFFTLDMETLYGVSGGITSYLIILIQFNLAAQQAKEAIQTF 492
            :||.:::.:.||.|.:..:.||..|||.:|...|..::..||:|::|.|||........:|....
Mosquito    15 DLLAKMLENFSLLLQHTPMSFSLGGFFDMDFVLLKEIAAAITTYMVIFIQFMPKEDTPTDATTAS 79

  Fly   493 NS--LNDTA 499
            ||  .|.||
Mosquito    80 NSTLANSTA 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr66aNP_523971.3 7tm_7 21..478 CDD:462463 17/49 (35%)
LOC1279272XP_318967.4 None

Return to query results.
Submit another query.