DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr66a and Gr36a

Sequence 1:NP_523971.3 Gene:Gr66a FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster

Alignment Length:484 Identity:85/485 (18%)
Similarity:172/485 (35%) Gaps:128/485 (26%)


  Fly    18 LFFISKIAGILPQDLEKFRSRNLLEKSRNGMIY--MLSTLILYVVL------YNILIYSFGEEDR 74
            |::..:|.|::..:::..|.|  :..::.|:::  .::.||..|:|      :|:.:| ||    
  Fly    12 LYYYGQIIGLINFEIDWQRGR--VVAAQRGILFAIAINVLICMVLLLQISKKFNLDVY-FG---- 69

  Fly    75 SLKASQSTLTFVIGLFLTYIGLIMMVSDQLTALRNQGRIGELYERIRLVDERLYKEGCVMDNSTI 139
              :|:|          |....:|:|||     ||....|..:..|.|                  
  Fly    70 --RANQ----------LHQYVIIVMVS-----LRMASGISAILNRWR------------------ 99

  Fly   140 GRRIRIMLIMTVIFELSILVSTYVKLVDYSQWMSLL-WIVSAIPTFI------NTLDKIWFAVSL 197
             :|.::|.::..:..| .|...:||  ..|:|..|: :.|..:..|:      .:||::.|...:
  Fly   100 -QRAQLMRLVECVLRL-FLKKPHVK--QMSRWAILVKFSVGVVSNFLQMAISMESLDRLGFNEFV 160

  Fly   198 YALKERFEAINATLEELVDTHEKHKLWLRGNQEVPPPLDSSQPPQYDSNLEYLYKELGGMDIGSI 262
            ....:.:  ::|.:...:..|....|::|.                      .|..|        
  Fly   161 GMASDFW--MSAIINMAISQHYLVILFVRA----------------------YYHLL-------- 193

  Fly   263 GKSSVSGSGKNKVAPVAHSMNSFGEAIDAASRKPPPPPLATNMVHESELGNAAKVEEKLNNLCQV 327
                     |.:|....|......|..         |..|..|.      ....:.::::|:.::
  Fly   194 ---------KTEVRQAIHESQMLSEIY---------PRRAAFMT------KCCYLADRIDNIAKL 234

  Fly   328 HDEICEIGKALNELWSYPILSLMAY-GFLIFTAQLYFLYCATQYQSIPSLFRSAKNPFITVIVLS 391
            .:::..|...||::  :.|..:|.| |:.||:....::..:.....|..|..|.:   ...:|.|
  Fly   235 QNQLQSIVTQLNQV--FGIQGIMVYGGYYIFSVATTYITYSLAINGIEELHLSVR---AAALVFS 294

  Fly   392 -----YTSGKCVYLIYLSWKTSQASKRTGISLHKCGVVADDNLLYEIVNHLSLKLLNHSVDFSAC 451
                 |||......:.|............:........|.|..|.:....:.|:|:.:.:.....
  Fly   295 WFLFYYTSAILNLFVMLKLFDDHKEMERILEERTLFTSALDVRLEQSFESIQLQLIRNPLKIEVL 359

  Fly   452 GFFTLDMETLYGVSGGITSYLIILIQFNL 480
            ..||:...:...:.|.|.:..|.|||:::
  Fly   360 DIFTITRSSSAAMIGSIITNSIFLIQYDM 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 84/478 (18%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 85/485 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.