DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr66a and Gr93b

Sequence 1:NP_523971.3 Gene:Gr66a FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_732664.2 Gene:Gr93b FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster

Alignment Length:487 Identity:93/488 (19%)
Similarity:175/488 (36%) Gaps:141/488 (29%)


  Fly    19 FFISKIAGILPQDLEKFRSRNLLEKSRNGMIYMLSTLILYVVLYNILIYSF----GE-EDRSLKA 78
            |......|::...:|: :...|:..:|.|  |:...|::.::......||:    |: ||..|:|
  Fly    28 FLYGTFFGVITFRIER-KDSQLVAINRRG--YLWICLVIRLLASCFYGYSYDAWSGQYEDMYLRA 89

  Fly    79 SQSTLTF----VIGLFLTYIGLIMMVSDQLTALRNQGRIGELYERIRLVDE--RLYKEGCVMDNS 137
                  |    :||..:..:.:::|          |...||  |.|.||:.  :|::....:.||
  Fly    90 ------FFGFRLIGCLICSVIILVM----------QFWFGE--ELINLVNRFLQLFRRMQSLTNS 136

  Fly   138 ---TIGRRIRIMLIMTVIFELSILVSTYVKLVDYSQWMSLLWIVSAIPTFINT--LDKIWFAVSL 197
               ..|.|...:|:.:.:|.|..:...:..::  |.|. ||.:|..:.|.:.|  :..:.|...|
  Fly   137 PKNRFGDRAEFLLMFSKVFSLLFVFMAFRLML--SPWF-LLTLVCDLYTSVGTGMITHLCFVGYL 198

  Fly   198 YALKERFEAINATLEELVDTHEKHKLWLRGNQEVPPPLDSSQPPQYDSNLEYLYKELGGMDIGSI 262
                                                            ::..||::|.......:
  Fly   199 ------------------------------------------------SIGVLYRDLNNYVDCQL 215

  Fly   263 GKSSVSGSGKNKVAPVAHSMNSFGEAIDAASRKPPPPPLATNMVHESELGNAAKVEEKLNNL--C 325
            .....|.:|:|         |||        |..|.|                 ..:.::||  |
  Fly   216 RAQLRSLNGEN---------NSF--------RNNPQP-----------------TRQAISNLDKC 246

  Fly   326 -QVHDEICEIGKALNELWSYPILSLMAYGFLIFTAQLYFLYCATQYQSIPSLFRSAKNPFITVIV 389
             .::|||.::.::..:|:..|:...:|...|..:...|......||..  :|:.......|.|::
  Fly   247 LYLYDEIHQVSRSFQQLFDLPLFLSLAQSLLAMSMVSYHAILRRQYSF--NLWGLVIKLLIDVVL 309

  Fly   390 LSYTSGKCVYLIYLSWKTSQASKRTGISLHKCGVVADDNLLYEIVNHLSLKLLNH-SVDFSACGF 453
            |:.:       ::.:...|:..:|....    .....|:..|.....|.|..|.| .:.....|.
  Fly   310 LTMS-------VHSAVNGSRLIRRLSFE----NFYVTDSQSYHQKLELFLGRLQHQELRVFPLGL 363

  Fly   454 FTLDME-TLYGVSGGITSYLIILIQFNLAAQQ 484
            |.:..| ||:.:|..:| ||:.|:|:.:.:||
  Fly   364 FEVSNELTLFFLSAMVT-YLVFLVQYGMQSQQ 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 90/478 (19%)
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 91/483 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.