DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr66a and Gr22f

Sequence 1:NP_523971.3 Gene:Gr66a FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_722729.2 Gene:Gr22f FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster

Alignment Length:452 Identity:93/453 (21%)
Similarity:165/453 (36%) Gaps:116/453 (26%)


  Fly    50 YMLSTLILYVVLYNILIYSFGEEDRSLKASQSTLTFVIGLFLTYIGLIMMVSDQLTALRNQGRIG 114
            :||.|.:....|..:..::|....:.||.|:..|.:  |..|..:.:.:.:|..|.:  .|.|..
  Fly    17 FMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLY--GFVLHSLAMCLAMSSHLAS--KQRRKY 77

  Fly   115 ELYERIRLVDERLYKEGCVMDNSTIGRRIRIMLIMTVIFELSILVSTYVKLVDYSQWMSLLWIVS 179
            ..:||..|: |::|                :...:|..|.:|:|:...|       |.|      
  Fly    78 NAFERNPLL-EKIY----------------MQFQVTTFFTISVLLLMNV-------WKS------ 112

  Fly   180 AIPTFINTLDKIWFAVSLYALKERFEAINATLEELVDTH----EKHKLWLRGNQEVPPPLDSSQP 240
                  ||:.||  |..|..|:.:.:.: .||:...:.:    :||...: |...:.......|.
  Fly   113 ------NTVRKI--ANELLTLEGQVKDL-LTLKNCPNFNCFVIKKHVAAI-GQFVISIYFCLCQE 167

  Fly   241 PQYDSNLEYLYKELGGMDIGSIGKSSVSGSGKNKVAPVAHSMNSFGEAIDAASRKPPPPPLATNM 305
            ..|...|:.|      ..:.|:|...:......::..|...:....|.::.:..      |:::.
  Fly   168 NSYPKILKIL------CCLPSVGLQLIIMHFHTEIILVYRYVWLVNETLEDSHH------LSSSR 220

  Fly   306 VHESELGNAAKVEEKLNNLCQVHDEICEIGK---ALNELWSYPILSLMAYGFLI-FTAQLYFL-- 364
            :|.               |..::|.:.::.:   |.|:|.    |.||...:|| .|.|::||  
  Fly   221 IHA---------------LASLYDRLLKLSELVVACNDLQ----LILMLIIYLIGNTVQIFFLIV 266

  Fly   365 ----------YCATQYQSIPSLFRSAKNPFITVIVLSYTSGKCVYLIYLSWKTSQASKRTGISLH 419
                      |.....|.|.:.:     .|...||:...:|||      ..:||:..|......|
  Fly   267 LGVSMNKRYIYLVASPQLIINFW-----DFWLNIVVCDLAGKC------GDQTSKVLKLFTDLEH 320

  Fly   420 KCGVVADDNLLYEIVNHLSLKLLNHSVDFSACGFFTLDMETLYGVSGGITS--YLIILIQFN 479
                  ||..|...:|..:....:....|..||.|:::..  .|....|||  ||:.|:||:
  Fly   321 ------DDEELERSLNEFAWLCTHRKFRFQLCGLFSINHN--MGFQMIITSFLYLVYLLQFD 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 92/450 (20%)
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 92/451 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.