DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbp2 and Secisbp2l

DIOPT Version :9

Sequence 1:NP_648204.1 Gene:Sbp2 / 38934 FlyBaseID:FBgn0087039 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_808276.2 Gene:Secisbp2l / 70354 MGIID:1917604 Length:1089 Species:Mus musculus


Alignment Length:355 Identity:94/355 - (26%)
Similarity:152/355 - (42%) Gaps:62/355 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KITPRSSKYKNQHRKREQQTSLLDFVIKPRPKTQRQTKAHKLQKT----HLAIT----------R 69
            |:....||...:..|...|..|.| ::....|.|:..||.::..|    |..:|          |
Mouse   470 KLQEALSKAAGKKTKTPVQLDLGD-MLAALEKQQQAMKARQITNTRPLAHPVVTTATFHTKDSNR 533

  Fly    70 GSYIVYKP----------------KGKTRLDPK-KKITRLKKSVRVYRTSKKAEREVAE------ 111
            .:....:|                |||.:...| |:.|.|||.:...|..||. |.:.|      
Mouse   534 KTLAKSQPCVTSFNSLDITSSKAKKGKEKEIAKLKRPTALKKVILKEREEKKG-RLIVEHSVLGA 597

  Fly   112 -----------NDLEGVPVVGQDIN---PNAIPLEQQVQNLSLSKTPAP---------NNPSQAK 153
                       |||....|..:|..   |:...|....||.....||..         .:|..:.
Mouse   598 EEPTETHLDLTNDLPQETVSQEDAGLSMPSDASLSPASQNSPYCMTPVSQGSPASSGIGSPMASS 662

  Fly   154 TVHAIHSRRFRSYCDNCTRPRLKELSTQLLRDLDRFQKRAFAKNEIKARAHPRLVLGVREALARL 218
            |:..|||:|||.||:......:.|..|.||::|..||:|.:.|:.::|:|..|||:|:||....:
Mouse   663 TITKIHSKRFREYCNQVLSKEIDECVTLLLQELVSFQERIYQKDPVRAKARRRLVMGLREVTKHM 727

  Fly   219 RINKVKLLFLATDCEICPGESGLDATIEGLKFQCQQQQVPYCFPLLRRELSYALQKRAQICCVAI 283
            ::||:|.:.::.:||....:.|||..:..:....::|::|:.|.|.|:.|...:.|...:..|.|
Mouse   728 KLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGI 792

  Fly   284 LDFDGANATYADLLNEIEDARAEYKRRTAS 313
            .::.||.:.:..|:...|:||..||...|:
Mouse   793 FNYFGAESLFNRLVELTEEARKAYKDMVAA 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sbp2NP_648204.1 Ribosomal_L7Ae 200..290 CDD:279573 26/89 (29%)
Secisbp2lNP_808276.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..207
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..386
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 618..660 8/41 (20%)
Ribosomal_L7Ae 700..802 CDD:279573 29/101 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 883..907
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 922..1089
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845786
Domainoid 1 1.000 66 1.000 Domainoid score I9896
eggNOG 1 0.900 - - E1_28N3Y
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43423
orthoMCL 1 0.900 - - OOG6_105656
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5622
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.670

Return to query results.
Submit another query.