powered by:
Protein Alignment Sbp2 and Cks30A
DIOPT Version :9
| Sequence 1: | NP_648204.1 |
Gene: | Sbp2 / 38934 |
FlyBaseID: | FBgn0087039 |
Length: | 313 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_476947.1 |
Gene: | Cks30A / 34250 |
FlyBaseID: | FBgn0010314 |
Length: | 74 |
Species: | Drosophila melanogaster |
| Alignment Length: | 37 |
Identity: | 11/37 - (29%) |
| Similarity: | 22/37 - (59%) |
Gaps: | 3/37 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 44 VIKPRPKTQRQTKAHKLQKTHLAITRG--SYIVYKPK 78
::|..|||...|:| :.:...:..:|| .|:::||:
Fly 27 LVKMVPKTHLMTEA-EWRSIGVQQSRGWIHYMIHKPE 62
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| Sbp2 | NP_648204.1 |
Ribosomal_L7Ae |
200..290 |
CDD:279573 |
|
| Cks30A | NP_476947.1 |
CKS |
7..72 |
CDD:395882 |
11/37 (30%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
1 |
1.000 |
- |
- |
|
otm48570 |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.
