DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbp2 and Secisbp2l

DIOPT Version :9

Sequence 1:NP_648204.1 Gene:Sbp2 / 38934 FlyBaseID:FBgn0087039 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_038960483.1 Gene:Secisbp2l / 296115 RGDID:1559930 Length:1093 Species:Rattus norvegicus


Alignment Length:354 Identity:92/354 - (25%)
Similarity:150/354 - (42%) Gaps:60/354 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KITPRSSKYKNQHRKREQQTSLLDFVIKPRPKTQRQTKAHKLQKT----HLAITRGSYIVYKPKG 79
            |:....||...:..|...|..|.| ::....|.|:..||.::..|    |..:|.|::.......
  Rat   474 KLQEALSKAAGKKNKTPVQLDLGD-MLAALEKQQQAMKARQITNTRPLAHPVVTTGTFHTKDSNR 537

  Fly    80 K--TRLDP-------------------------KKKITRLKKSVRVYRTSKKAE----------R 107
            |  ||..|                         .|:.|.|||.:...|..||..          .
  Rat   538 KTLTRSQPCLTSFNSLDITSSKAKKGKEKEIAKLKRPTALKKVILKEREEKKGRLTVEHSVLGAE 602

  Fly   108 EVAE------NDLEGVPVVGQDIN---PNAIPLEQQVQNLSLSKTPAP---------NNPSQAKT 154
            |:.|      |||....:..:|..   |:...|....||.....||..         .:|..:.|
  Rat   603 ELTETNLDLANDLPQETISQEDTGLSMPSDASLSPASQNSPYCMTPVSQGSPASSGIGSPMASST 667

  Fly   155 VHAIHSRRFRSYCDNCTRPRLKELSTQLLRDLDRFQKRAFAKNEIKARAHPRLVLGVREALARLR 219
            :..|||:|||.||:......:.|..|.||::|..||:|.:.|:.::|:|..|||:|:||....::
  Rat   668 ITKIHSKRFREYCNQVLSKEIDECVTLLLQELVSFQERIYQKDPVRAKARRRLVMGLREVTKHMK 732

  Fly   220 INKVKLLFLATDCEICPGESGLDATIEGLKFQCQQQQVPYCFPLLRRELSYALQKRAQICCVAIL 284
            :||:|.:.::.:||....:.|||..:..:....::|::|:.|.|.|:.|...:.|...:..|.|.
  Rat   733 LNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIF 797

  Fly   285 DFDGANATYADLLNEIEDARAEYKRRTAS 313
            ::.||.:.:..|:...|:||..||...|:
  Rat   798 NYFGAESLFNRLVELTEEARKAYKDMVAA 826

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sbp2NP_648204.1 Ribosomal_L7Ae 200..290 CDD:279573 26/89 (29%)
Secisbp2lXP_038960483.1 Ribosomal_L7Ae 704..806 CDD:396000 29/101 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349203
Domainoid 1 1.000 66 1.000 Domainoid score I9702
eggNOG 1 0.900 - - E1_28N3Y
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45489
orthoMCL 1 0.900 - - OOG6_105656
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.640

Return to query results.
Submit another query.