DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbp2 and secisbp2

DIOPT Version :9

Sequence 1:NP_648204.1 Gene:Sbp2 / 38934 FlyBaseID:FBgn0087039 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001090731.1 Gene:secisbp2 / 100036714 XenbaseID:XB-GENE-1004872 Length:561 Species:Xenopus tropicalis


Alignment Length:279 Identity:89/279 - (31%)
Similarity:126/279 - (45%) Gaps:53/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KGKTRLDPK-KKITRLKKSVRVYRTSKKAEREVAENDL-----------EGVPVVGQDINPN--- 127
            |||.|..|| ||.|.|||.:...|..:|.....|..:|           .|.||  |.|:|:   
 Frog   218 KGKQREVPKAKKPTSLKKIILKEREERKQRLTSATQELTPQGSHILSDGAGPPV--QSISPSEGD 280

  Fly   128 -AIPL--------EQQVQNLSLSKT------PAPNN----PSQA-KTVHAIHSRRFRSYC----- 167
             ..||        |..|::|.|..:      |...:    |.|: ..:..|||||||.||     
 Frog   281 CLGPLETALAEIQEDSVEDLILGNSEISAIQPVTESTVSLPQQSTSNLPKIHSRRFREYCSQVLS 345

  Fly   168 ---DNCTRPRLKELSTQLLRDLDRFQKRAFAKNEIKARAHPRLVLGVREALARLRINKVKLLFLA 229
               |||.        .:||::|.|||.|.|.|...||::..|||:|:||.|..|::.|:|.:.::
 Frog   346 KDVDNCV--------MELLKELVRFQDRLFLKEPAKAKSKRRLVMGLREVLKHLKLQKLKCIIIS 402

  Fly   230 TDCEICPGESGLDATIEGLKFQCQQQQVPYCFPLLRRELSYALQKRAQICCVAILDFDGANATYA 294
            .:||....:.|||.|::.:.....:|.||:.|.|.|:.|...|.|...:..|.:..:|||...:.
 Frog   403 PNCEKIQSKGGLDDTLQTIISHACEQNVPFVFALNRKALGRCLNKAVPVSVVGVFSYDGAQDHFH 467

  Fly   295 DLLNEIEDARAEYKRRTAS 313
            .|......||..||...|:
 Frog   468 KLCELTVQARQAYKDMIAA 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sbp2NP_648204.1 Ribosomal_L7Ae 200..290 CDD:279573 30/89 (34%)
secisbp2NP_001090731.1 Ribosomal_L7Ae 369..464 CDD:279573 32/94 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9795
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007151
OrthoInspector 1 1.000 - - otm48570
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6030
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.