DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13678 and CG12519

Sequence 1:NP_648193.1 Gene:CG13678 FlyBaseID:FBgn0035859 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001262046.1 Gene:CG12519 FlyBaseID:FBgn0036872 Length:131 Species:Drosophila melanogaster

Alignment Length:143 Identity:67/144 (47%)
Similarity:85/144 (59%) Gaps:29/144 (20%)


  Fly     1 MFKFAAIFFAVVAVAAAKPGIL-------APLA-AAPLAYTAPAVVGSAAYVAPYASSYTAHSVA 57
            |||.|.:..|:||.||||||:|       |||| :|||||:|||.|.:|.  ||..::.::..:|
  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP--APVVTATSSQVIA 63

  Fly    58 HS----AAFP--ASYAAPVAAAY-TAPIAAPLAAAYTAPYTRFATPYAA--AYTSPLAYSSPYVA 113
            .:    ||.|  |..||||.|.| .||:|||:.|.|.      |||.||  ||:||||||:|.  
  Fly    64 RNYNGIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYA------ATPLAAPLAYSSPLAYSAPL-- 120

  Fly   114 RPYVAAAAAPLLL 126
              ..|..:||||:
  Fly   121 --SYAVPSAPLLI 131



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.