| Sequence 1: | NP_648193.1 | Gene: | CG13678 / 38922 | FlyBaseID: | FBgn0035859 | Length: | 128 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001262045.1 | Gene: | CG32214 / 317919 | FlyBaseID: | FBgn0052214 | Length: | 116 | Species: | Drosophila melanogaster |
| Alignment Length: | 130 | Identity: | 64/130 - (49%) |
|---|---|---|---|
| Similarity: | 81/130 - (62%) | Gaps: | 18/130 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MFKFAAIFFAVVAVAAAKPGIL-APLA-AAPLAYTAPAVVGSAAYVAPYASSYTAHSVAHSAAFP 63
Fly 64 ASYAAPVAAAYTAPIAAPLAAAYTAPYTRFATPYAA--AYTSPLAYSSPYVARPYVAAAAAPLLL 126
Fly 127 126 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR35685 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||