DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13678 and 825-Oak

Sequence 1:NP_648193.1 Gene:CG13678 FlyBaseID:FBgn0035859 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_730410.2 Gene:825-Oak FlyBaseID:FBgn0052208 Length:129 Species:Drosophila melanogaster

Alignment Length:141 Identity:68/142 (48%)
Similarity:85/142 (60%) Gaps:27/142 (19%)


  Fly     1 MFKFAAIFFAVVAVAAAKPGIL-APLA-AAPLAYTAPAVVGSAAYVAPYASSYTAHSVAHS---- 59
            |||:|.:..|:||.||||||:| |||| .|||||:|||.|.:|.  ||..::.::..:|.:    
  Fly     1 MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAVVAAP--APVVTATSSQVIARNYNGI 63

  Fly    60 AAFP------ASYAAPVAAAYTA-PIAAPLAAAYTAPYTRFATPYAA--AYTSPLAYSSPYVARP 115
            ||.|      |..||||.|.|.| |:|||:.|.|.      |||.||  ||:||||||:|.    
  Fly    64 AAAPVIAPVAAPLAAPVVAKYAATPLAAPVVAKYA------ATPLAARLAYSSPLAYSAPL---- 118

  Fly   116 YVAAAAAPLLL 126
            ..|||.||.|:
  Fly   119 SYAAAPAPFLI 129



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.